[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56522.1
DDBJ      :             putative phosphoenolpyruvate-dependent sugar phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  380/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.84.3
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->145 2gprA PDBj 5e-18 35.5 %
:RPS:PDB   4->104 3bg5A PDBj 1e-10 10.2 %
:RPS:SCOP  4->143 1f3gA  b.84.3.1 * 1e-20 34.3 %
:HMM:SCOP  1->149 2gprA_ b.84.3.1 * 6.2e-32 39.0 %
:RPS:PFM   4->132 PF00358 * PTS_EIIA_1 2e-18 45.6 %
:HMM:PFM   3->125 PF00358 * PTS_EIIA_1 6.1e-28 34.2 120/133  
:BLT:SWISS 2->127 PTGA_STAAU 3e-21 41.5 %
:PROS 66->78|PS00371|PTS_EIIA_TYPE_1_HIS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56522.1 GT:GENE AAZ56522.1 GT:PRODUCT putative phosphoenolpyruvate-dependent sugar phosphotransferase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2930901..2931350) GB:FROM 2930901 GB:TO 2931350 GB:DIRECTION - GB:PRODUCT putative phosphoenolpyruvate-dependent sugar phosphotransferase GB:PROTEIN_ID AAZ56522.1 GB:DB_XREF GI:71916620 InterPro:IPR001127 LENGTH 149 SQ:AASEQ MLAVLAPVTGVAVGLSRVPDPMFAQGLVGPGTAIDPRKEVQEAVAPITGRIVSFHPHAFVVQSADGKGVLVHLGMNTVRLPLIRGFELLAAQGDEVTAGQPLIRWNPAEVVASGISPIVPIVALDADGDVISRPVSGEVKRGELLFRWA GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 2->127|PTGA_STAAU|3e-21|41.5|123/166| PROS 66->78|PS00371|PTS_EIIA_TYPE_1_HIS|PDOC00528| BL:PDB:NREP 1 BL:PDB:REP 2->145|2gprA|5e-18|35.5|141/154| RP:PDB:NREP 1 RP:PDB:REP 4->104|3bg5A|1e-10|10.2|98/1137| RP:PFM:NREP 1 RP:PFM:REP 4->132|PF00358|2e-18|45.6|125/132|PTS_EIIA_1| HM:PFM:NREP 1 HM:PFM:REP 3->125|PF00358|6.1e-28|34.2|120/133|PTS_EIIA_1| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00358|IPR001127| GO:PFM GO:0006810|"GO:transport"|PF00358|IPR001127| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00358|IPR001127| GO:PFM GO:0016020|"GO:membrane"|PF00358|IPR001127| RP:SCP:NREP 1 RP:SCP:REP 4->143|1f3gA|1e-20|34.3|137/150|b.84.3.1| HM:SCP:REP 1->149|2gprA_|6.2e-32|39.0|146/0|b.84.3.1|1/1|Duplicated hybrid motif| OP:NHOMO 868 OP:NHOMOORG 382 OP:PATTERN -------------------------------------------------------------------- ----1311223141-----------1-----------111-----1-11-1--12--------311111111---2-11---1-----------------------------------------------------------------------------------------------------1-----1-232222222332222223455543222121235233423122444444444444443222246-274-1515CC--6731433222333343334224444444443433333333333334334433333---564447547242-9112-11-1-1-2-2-----1---1--111--11---------------------------------------1-----------------------------------------------------------------------------------1--------11111111111111111111-111--1-----1------------------2----------------------------------------------------------------------1--111-------11111111111111111111-------11-11-23432423223333333-2333233323232333333333553232222222222222222322233332-222222222222--1---------------111312111111111------------11111212-------------------11111111111111-----------------2------11111111-------1---1-1------11------------------- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 98.7 SQ:SECSTR EEEEEEEEETTEEEEEEEEcccccccccccccccTTcccTTEEEccccEEEEEEccEEcTTcEEEEEEccccEEEEEccccEEEccEEcccTTcEEcTTcEEEEEcHHHHGGGcccccEEEEEGGGTcEEEEccccEEcTTccccEE## DISOP:02AL 148-150| PSIPRED cEEEEcccccEEEEHHHcccHHHccccccccEEEEEcccccEEEEcccEEEEEEEccEEEEEEccccEEEEEEcccEEEcccccccEEEEEcccEEEcccEEEEEcHHHHHHcccccEEEEEEEccccEEEEEEccccEEcccEEEEEc //