[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56526.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:284 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  157->237 1vchA1 c.61.1.1 * 9.5e-14 33.3 %
:HMM:PFM   134->233 PF00156 * Pribosyltran 8.3e-12 28.9 97/125  
:PROS 200->212|PS00103|PUR_PYR_PR_TRANSFER
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56526.1 GT:GENE AAZ56526.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2936925..2937779) GB:FROM 2936925 GB:TO 2937779 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56526.1 GB:DB_XREF GI:71916624 InterPro:IPR002375 LENGTH 284 SQ:AASEQ MLHPTAEAHRGGMVLCSVLTEWVSALADLVLEQHCAGCGGLDGPLCAACREVVDRGPWRCPARFGCPPVWAAGAYTGRGRAVLLAFKNGGYRALAEPLSRGLAAAVRAAAPTAERISLVPVPGRRSAVRKRGYDPVRTVGAAAAVRLRAQGVAARVVCPLRYSRPTRDQVGLGAAARWANLSGAMRARWPGKSPAVGDAVVVVDDVLTTGATLAEAARALTAAGIRVAGAAVVAERLCHVVTDPSQTATAGPARSPPGGAPHAMCREIQKSRWKTVPDNRAISG GT:EXON 1|1-284:0| PROS 200->212|PS00103|PUR_PYR_PR_TRANSFER|PDOC00096| SEG 103->113|aaavraaapta| SEG 195->234|avgdavvvvddvlttgatlaeaaraltaagirvagaavva| SEG 248->263|atagparsppggapha| HM:PFM:NREP 1 HM:PFM:REP 134->233|PF00156|8.3e-12|28.9|97/125|Pribosyltran| HM:SCP:REP 157->237|1vchA1|9.5e-14|33.3|81/0|c.61.1.1|1/1|PRTase-like| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ------------1-1----------------------1----------1111---1----1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 164-181, 249-254, 281-284| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccHHHcccccEEEEEccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHccccHHHHHHHHHHHHHcccccccccccccEEEEccHHHHcccHHHHHHHHcccEEEcccccccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccc //