[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56535.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->167 3btaA PDBj 3e-10 10.0 %
:RPS:PFM   161->280 PF01944 * DUF95 1e-11 29.2 %
:HMM:PFM   111->280 PF01944 * DUF95 5.1e-38 33.8 160/171  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56535.1 GT:GENE AAZ56535.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2947970..2948965) GB:FROM 2947970 GB:TO 2948965 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAZ56535.1 GB:DB_XREF GI:71916633 LENGTH 331 SQ:AASEQ MDLDLFIAERRPAWERLQTLVRRHRRLTGEEIDELVDLYQRVGTDLSVLRSTGHDPALAGWLSGLVARARAVITGAHAGSWRDFTRFFTRVFPATLYRLRWWWLAVTAVNLAVAFGVGVWIATTPEAQTAMGTPEEIRAYVEHDFANYYVEHPGASFAALVWTNNAWVAAQSIIFGAFLCLPAVYVLLLNSLNLGMAGGLMAAHGKTDIFFGLILPHGLLELTAVFIAGAVGIRIGWTFLAPGPRPRVQAVGEETRAAMGVALGLVVVLFVSGLIEGFVTGWVHITWLRIGIGVAAEACFLLYVFTLGRRAAQEGETGDIADAPQTVAVAG GT:EXON 1|1-331:0| TM:NTM 5 TM:REGION 101->123| TM:REGION 174->196| TM:REGION 214->236| TM:REGION 255->277| TM:REGION 285->307| SEG 187->203|lllnslnlgmagglmaa| SEG 257->274|aamgvalglvvvlfvsgl| RP:PDB:NREP 1 RP:PDB:REP 7->167|3btaA|3e-10|10.0|160/1277| RP:PFM:NREP 1 RP:PFM:REP 161->280|PF01944|1e-11|29.2|120/170|DUF95| HM:PFM:NREP 1 HM:PFM:REP 111->280|PF01944|5.1e-38|33.8|160/171|DUF95| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--1111111111111----1111-1-11--111--1----1----1111--------------------------------------------------------------------11--------1-------------------1----------------------------------------1--------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1----------------1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 48.3 SQ:SECSTR ######cccTTTTccHHHHHHHHHHHHTcHHHHHHHHHHHHccccccTTcGGEEE#EEcTTccEEEEEccEEEEEccccTTccEEEccccccccTEEEEccEEccccGGGTcTTcccccEEccHHHHHHHHHHHHHHHHTTccccTTcccccccccccccccccccH#################################################################################################################################################################### DISOP:02AL 330-331| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccEEEEEEcHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccEEcccc //