[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56539.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.88.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->174 3f51F PDBj 9e-04 43.4 %
:RPS:SCOP  346->412 1zq1A2  c.88.1.1 * 7e-04 20.9 %
:BLT:SWISS 223->329 ISPE_RHORT 5e-04 34.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56539.1 GT:GENE AAZ56539.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2952880..2954139 GB:FROM 2952880 GB:TO 2954139 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56539.1 GB:DB_XREF GI:71916637 LENGTH 419 SQ:AASEQ MCHVSSLRDLDPAVDRLPPDVRGRLVELDRLRDVWTANQRRRPSHQWPAHRARLFRRHILALHRLRGTLPVSEQTAERLVVDGFDSDNTLDAALREQLAAEEHTLISLAEASRTGERLSSAYLDEAARSLTGQSTPGLGERLAAVLADLAATPTHPVVRAALGYLAAEEAQRELGAEERFPRGTDPLAWAVASVALMRANHPPLIADHRAVAMQLPWPPAASSPDRHLPLIALFAELQIAVLRGELSWTVPERDDPAEYGQALARTVYRRLLEYLRQRAPALSMVLRQLDPASSARVTSGDSTELGEHRNRVELAADRALLARTHPSWWVCLEATCTNSTLRLLLTVQGVGAPATGVLAVTADALVDSPRGIEDALDLAPTDCVTLLSSDSADERWPEVAALTDEAISRAVDRLTSVMA GT:EXON 1|1-419:0| BL:SWS:NREP 1 BL:SWS:REP 223->329|ISPE_RHORT|5e-04|34.7|101/304| BL:PDB:NREP 1 BL:PDB:REP 90->174|3f51F|9e-04|43.4|76/93| RP:SCP:NREP 1 RP:SCP:REP 346->412|1zq1A2|7e-04|20.9|67/363|c.88.1.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 18.1 SQ:SECSTR #########################################################################################HHHHHHHHHHHHTccHHHHHHHH####TccHHHHHHHHTTcccccH####HHHHHHHHHTTccHHHHHHHHH#HHHHHHHHHHHH##################################################################################################################################################################################################################################################### DISOP:02AL 1-5, 173-174, 294-304| PSIPRED cccccHHHHccHHHHHccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHEEEEEccccccHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHcccccccHHHHHHHHHHHHHccccccEEcccEEEEEccccccccccccccHHHHHHHHHHHEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEEccccccccEEEEEHHHHHcccccHHHHHHcccHHHHHHHccccccHHccHHHHHHHHHHHHHHHHHHHHcc //