[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56544.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->126 PF12005 * DUF3499 1e-21 65.0 %
:HMM:PFM   13->128 PF12005 * DUF3499 4.5e-55 62.9 116/124  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56544.1 GT:GENE AAZ56544.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2958418..2958864) GB:FROM 2958418 GB:TO 2958864 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56544.1 GB:DB_XREF GI:71916642 LENGTH 148 SQ:AASEQ MVRKGIPSVYVSVSRRCSRTACRQPAVFTLTYVYADSTAVLGPLAAYVEPHCYDLCAMHADRLTAPLGWEIVRLPADTATGGPGSDDLEALANAVREAGRQPVKKPRPEPTGQGIETIRRGHLRVLRSEPVRPDDQPDRPPRRPPYDV GT:EXON 1|1-148:0| SEG 8->19|svyvsvsrrcsr| SEG 130->147|pvrpddqpdrpprrppyd| RP:PFM:NREP 1 RP:PFM:REP 22->126|PF12005|1e-21|65.0|103/121|DUF3499| HM:PFM:NREP 1 HM:PFM:REP 13->128|PF12005|4.5e-55|62.9|116/124|DUF3499| OP:NHOMO 61 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- ----1-11111--111111-11111111111111111111111111111111111111--11111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 100-114, 130-148| PSIPRED cccccccEEEEccccccccccccccEEEEEEEEEcccEEEEcccccccccccHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccEEEEEEcEEEEEcccccccccccccccccccccc //