[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56612.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->70 PF06050 * HGD-D 0.00063 27.5 69/347  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56612.1 GT:GENE AAZ56612.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3038435..3038713 GB:FROM 3038435 GB:TO 3038713 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56612.1 GB:DB_XREF GI:71916710 LENGTH 92 SQ:AASEQ MGEDLERLDTDELRERAVELARKRWDVSYLWKLVEHIPSAEALAGRPAAGQAGVHTVSALFSQLIAEFEGDHQLREALRPLYLDYLRQHQGT GT:EXON 1|1-92:0| HM:PFM:NREP 1 HM:PFM:REP 2->70|PF06050|0.00063|27.5|69/347|HGD-D| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 90-92| PSIPRED cccHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccc //