[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56619.1
DDBJ      :             carbon monoxide dehydrogenase
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  331/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
a.56.1d.15.4
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->153 1ffuD PDBj 2e-22 38.7 %
:RPS:PDB   7->148 3b9jA PDBj 3e-25 29.1 %
:RPS:SCOP  1->78 1dgjA2  d.15.4.2 * 3e-14 28.2 %
:RPS:SCOP  79->153 1ffuA1  a.56.1.1 * 4e-12 29.3 %
:HMM:SCOP  1->78 1n62A2 d.15.4.2 * 2.7e-18 42.3 %
:HMM:SCOP  79->158 1t3qA1 a.56.1.1 * 1.9e-16 40.0 %
:RPS:PFM   73->144 PF01799 * Fer2_2 5e-06 36.1 %
:HMM:PFM   73->145 PF01799 * Fer2_2 9.6e-20 42.5 73/75  
:HMM:PFM   6->56 PF00111 * Fer2 4.6e-08 35.3 51/77  
:BLT:SWISS 4->156 DCMS_HYDPS 5e-22 37.9 %
:PROS 39->47|PS00197|2FE2S_FER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56619.1 GT:GENE AAZ56619.1 GT:PRODUCT carbon monoxide dehydrogenase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3052205..3052702 GB:FROM 3052205 GB:TO 3052702 GB:DIRECTION + GB:PRODUCT carbon monoxide dehydrogenase GB:PROTEIN_ID AAZ56619.1 GB:DB_XREF GI:71916717 InterPro:IPR002888 InterPro:IPR006058 LENGTH 165 SQ:AASEQ MPGIGVTVDGTRYEDEVDACLPLSQYLRERKSGGIPVDCPTAECGACLVLVDGVAVKSCLMLAVQTDGCTVTTVDGLADDATAHSLQKAFRRHVRRCTRCRPGLVVAAVELLRGCSSPSEQEIHEGLSGVRCPCGSDADIVRAVCEAADAVQDADTQLPETRVVG GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 4->156|DCMS_HYDPS|5e-22|37.9|153/163| PROS 39->47|PS00197|2FE2S_FER_1|PDOC00175| TM:NTM 1 TM:REGION 44->65| SEG 91->101|rrhvrrctrcr| BL:PDB:NREP 1 BL:PDB:REP 4->153|1ffuD|2e-22|38.7|150/156| RP:PDB:NREP 1 RP:PDB:REP 7->148|3b9jA|3e-25|29.1|141/162| RP:PFM:NREP 1 RP:PFM:REP 73->144|PF01799|5e-06|36.1|72/75|Fer2_2| HM:PFM:NREP 2 HM:PFM:REP 73->145|PF01799|9.6e-20|42.5|73/75|Fer2_2| HM:PFM:REP 6->56|PF00111|4.6e-08|35.3|51/77|Fer2| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01799|IPR002888| GO:PFM GO:0046872|"GO:metal ion binding"|PF01799|IPR002888| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01799|IPR002888| RP:SCP:NREP 2 RP:SCP:REP 1->78|1dgjA2|3e-14|28.2|78/80|d.15.4.2| RP:SCP:REP 79->153|1ffuA1|4e-12|29.3|75/76|a.56.1.1| HM:SCP:REP 1->78|1n62A2|2.7e-18|42.3|78/79|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 79->158|1t3qA1|1.9e-16|40.0|80/81|a.56.1.1|1/1|CO dehydrogenase ISP C-domain like| OP:NHOMO 959 OP:NHOMOORG 390 OP:PATTERN 113-1-2322223323--21111-2---1--------------------------------1------ 13813------------11-12--5711111333331168-11211---11-1-1-----1-9-1473331-------1---3------------------1-244-4----------------------------22211----5-1-111---------------1-2--------------12-------1-----1---------11---1----21-----------1--------------------1----------------------------------------------------------------------42-13333223313-3------2--11-112-211121-112-------3--2111-----13FGH41136484------------99C88B79452-4113--522-597323-54-33334341111111152231421------------------------------2341-344436886861----55771111-153DA8B2-2553222--41217111--111------------2-1--2-2111-1-111--11131112-1--13-4-------------------------111--2111-1--1----11-111-11----1----1---------1--1--2221211-21-2222111212211221221------------------------31--1111-----------------------------21------------------------113-44341163332332222---------1--------------1122222------------------------------------------------------2211------3- ---------------11-1111111111112111111111111---1----------11---------------------------------1----------------1-----------------------------------------------------1-------11---------------21--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 97.6 SQ:SECSTR EEcEEEEETTEEEETTccTTccHHHHHHHHTccccccccccccccTTEEEEEEEEEETTTccGGGcTTcEEEcGGGTcTTccccHHHHHHHHTTcccccTTHHHHHHHHHHHHHcccccHHHHHHHTTTccccccccHHHHHHHGGGcHHHTccTTcccGG#### DISOP:02AL 153-154, 157-162, 164-165| PSIPRED ccEEEEEEccEEEEEEccccccHHHHHHHcccccccEEcccccccEEEEEEccEEHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccc //