[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56620.1
DDBJ      :             molybdopterin dehydrogenase
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  218/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.87.2
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->226 1ffvC PDBj 6e-38 36.4 %
:RPS:PDB   9->187 2ckjA PDBj 2e-21 16.8 %
:RPS:SCOP  13->180 1rm6B2  d.145.1.3 * 1e-33 34.7 %
:RPS:SCOP  220->286 1t3qC1  d.87.2.1 * 4e-06 20.9 %
:HMM:SCOP  7->181 1rm6B2 d.145.1.3 * 1.5e-49 43.7 %
:HMM:SCOP  184->286 1t3qC1 d.87.2.1 * 1e-16 38.8 %
:RPS:PFM   11->178 PF00941 * FAD_binding_5 5e-25 40.5 %
:HMM:PFM   13->180 PF00941 * FAD_binding_5 2.6e-48 36.3 168/171  
:HMM:PFM   193->283 PF03450 * CO_deh_flav_C 1.2e-15 42.9 91/103  
:BLT:SWISS 7->226 DCMM_HYDPS 1e-36 35.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56620.1 GT:GENE AAZ56620.1 GT:PRODUCT molybdopterin dehydrogenase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3052699..3053562 GB:FROM 3052699 GB:TO 3053562 GB:DIRECTION + GB:PRODUCT molybdopterin dehydrogenase GB:PROTEIN_ID AAZ56620.1 GB:DB_XREF GI:71916718 LENGTH 287 SQ:AASEQ MSGDNGVLPPGCEYARAHSIAEAVQILGESLEGRVLAGGQSLVPLLRSHQVCPDVLVDLGGVAELRGVRDEGDSLWIGALTTYHEVASHPLVRSHAPLLARVAGVIADPAVRHRGTVGGALAYADPAFELPTAAVALGAECRITGPAGERGVPAAHFFVAKRTTAIGPDELVTGIRVPKWPGWSFHYERFPTDRRSWAIGGAAAGVRRGDGVIAAARVVLGNVGPTPLRAATVEAACIGLPSRAALLRAAARAVDEVLPSDSASGDVEHRGLARVLTGRALITAAGV GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 7->226|DCMM_HYDPS|1e-36|35.9|220/287| SEG 198->219|aiggaaagvrrgdgviaaarvv| SEG 243->253|raallraaara| BL:PDB:NREP 1 BL:PDB:REP 7->226|1ffvC|6e-38|36.4|220/287| RP:PDB:NREP 1 RP:PDB:REP 9->187|2ckjA|2e-21|16.8|179/1264| RP:PFM:NREP 1 RP:PFM:REP 11->178|PF00941|5e-25|40.5|168/171|FAD_binding_5| HM:PFM:NREP 2 HM:PFM:REP 13->180|PF00941|2.6e-48|36.3|168/171|FAD_binding_5| HM:PFM:REP 193->283|PF03450|1.2e-15|42.9|91/103|CO_deh_flav_C| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00941|IPR002346| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00941|IPR002346| RP:SCP:NREP 2 RP:SCP:REP 13->180|1rm6B2|1e-33|34.7|167/216|d.145.1.3| RP:SCP:REP 220->286|1t3qC1|4e-06|20.9|67/109|d.87.2.1| HM:SCP:REP 7->181|1rm6B2|1.5e-49|43.7|174/0|d.145.1.3|1/1|FAD-binding domain| HM:SCP:REP 184->286|1t3qC1|1e-16|38.8|103/109|d.87.2.1|1/1|CO dehydrogenase flavoprotein C-terminal domain-like| OP:NHOMO 405 OP:NHOMOORG 241 OP:PATTERN 112---2322223323--21111-----1--------------------------------1------ --312------------11-11--341111111222-1351113--------1-11----1-8--351121-----------3----------------------1------------------------------11111----5-----1--------------------------------1----------------------------------1--------------------------------------------------------------------------------------------------------22-111111-1-1------------1----1----121-112---------------------6462112437411111-111-1-1151-513331-2--12242112512---4311111223--------3----211--------------------------------2--2221----1--1------33------1-83561--221---11111-21-2-----------------1--1-1------1------1111---2----1--2-------------------------111-----1-1-------------------------1------------1--1111111111-111111111111111111--------------------------1--1111-----------------------------11---------------------------1----1111-21211122-------------1---------------------------1-------------------------------------------12---------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 95.8 SQ:SECSTR ######ccccccEEEEcccHHHHHHHHHHcTTcEEccccTTHHHHHHHccccccEEEEccccGGGccEEEcccEEEEETTccHHHHHHHTTTTHHHHHHHHHHTTcccHHHHTTccHHHHHHcccTTcccHHHHHHHTcccEEEcTTccccccccTTccccTTccccTTcEEEEEEEEcccTTEEEEEEEcccccccEEEEEEEEccTTcccccEEEEEEETcccccEEcTHHHHHTTTccccHHHHHHHHHHHHHTcccccTTccHHHHHHHHHHHHHHH###### DISOP:02AL 1-7| PSIPRED cccccccccccccEEccccHHHHHHHHHHccccEEEEccccHHHHHHcccccccEEEEccccccccEEEEcccEEEEEEcccHHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHcccEEEEEccccEEEEEHHHHcccccccccccccEEEEEEEEccccccEEEEEEEcccccccEEEEEEEEEEcccEEEEEEEEEEccccccEEHHHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcc //