[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56628.1
DDBJ      :             IMP dehydrogenase related 2
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  699/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
c.1.5
:370 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->367 2qr6A PDBj 7e-71 46.3 %
:RPS:PDB   13->367 1eepB PDBj 8e-23 25.4 %
:RPS:SCOP  15->367 1ak5A1  c.1.5.1 * 3e-43 24.9 %
:HMM:SCOP  8->372 1pvnA1 c.1.5.1 * 3e-76 41.2 %
:RPS:PFM   19->76,148->296 PF00478 * IMPDH 3e-19 47.8 %
:HMM:PFM   15->298 PF00478 * IMPDH 3.7e-41 35.7 249/351  
:BLT:SWISS 4->367 Y3444_MYCBO 3e-82 45.6 %
:PROS 68->75|PS00687|ALDEHYDE_DEHYDR_GLU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56628.1 GT:GENE AAZ56628.1 GT:PRODUCT IMP dehydrogenase related 2 GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3063796..3064908) GB:FROM 3063796 GB:TO 3064908 GB:DIRECTION - GB:PRODUCT IMP dehydrogenase related 2 GB:PROTEIN_ID AAZ56628.1 GB:DB_XREF GI:71916726 InterPro:IPR002086 InterPro:IPR003009 InterPro:IPR005992 LENGTH 370 SQ:AASEQ MAQVEIGLGKAGRRAYELDEIGIVPARRTRDPEEVSLSWQIDAYRFDTPLMVSPMDSVVSPKTAIAIGELGGLAVLDLEGLWTRYEDPEPLLAEIRELDDATATRRLQEIYAEPIKEELIGRRIEEIRRAGVVTAARLSPQRTAQYHKAVIEAGVDIFVIRGTTVSAEHVSGRTEPLNLKQFIYDLDVPVVVGGCATYTAALHLMRTGAAGVLVGFGGGSGHTTRSVLGVAVPMATAIGDVAAARRDYLDESGGRYVHVIADGGMTRSGDIAKALACGADAVMVGSPLARAVEAPGGGYHWGSEAHHHQLPRGQRLKVGTIGTLEEIVRGPASTSDGSMNLMGALRRTMATAGYTDVKEFQRVEVVVAPN GT:EXON 1|1-370:0| BL:SWS:NREP 1 BL:SWS:REP 4->367|Y3444_MYCBO|3e-82|45.6|364/375| PROS 68->75|PS00687|ALDEHYDE_DEHYDR_GLU|PDOC00068| SEG 115->129|ikeeligrrieeirr| SEG 208->221|gaagvlvgfgggsg| BL:PDB:NREP 1 BL:PDB:REP 4->367|2qr6A|7e-71|46.3|341/363| RP:PDB:NREP 1 RP:PDB:REP 13->367|1eepB|8e-23|25.4|303/314| RP:PFM:NREP 1 RP:PFM:REP 19->76,148->296|PF00478|3e-19|47.8|196/459|IMPDH| HM:PFM:NREP 1 HM:PFM:REP 15->298|PF00478|3.7e-41|35.7|249/351|IMPDH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 15->367|1ak5A1|3e-43|24.9|301/329|c.1.5.1| HM:SCP:REP 8->372|1pvnA1|3e-76|41.2|308/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 852 OP:NHOMOORG 747 OP:PATTERN ----------------1-------1----12--11-11-----1-1-1------11111111111-11 1111112233323222233-3211223333323222222222222222222222222222222212123232222222----11111111111111---111111-111-1-------11-111-111-1-1-1-1111111111-11111111111111111111111121111111111111-11111111111111111111111111111111111111112222212-11111111111111111111111111111111-1111111-11111111111111111111111111111111111111111111111111111-111111111111111---1111111111--111-11111111111111---1--1--11-----------------------11-11-11--11-11111111-----1-11111-111111111111111111-121111111111---------------1-11---1111---111111111111--11111111111111111111111111-111-11111111111111111-111-2-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111-------11--1------------------------------------11-----------------1---------11111111111111111111122221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------11111-1--------1-------------1------1-111111111-1 ---1----21----1---------------------------------------------------------------------------------11111----2-1--2-----------------------------------------------1------------121-1----------123-1111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 368 STR:RPRED 99.5 SQ:SECSTR ##cEEHHcccccccccccTTEEEccccccccGGGccccEEETTEEEcccEEEcccTTTccHHHHHHHHHHTcEEEEcccccHHHHHHHHHHTcccTTccccTTcccccEEEEcccHHHHHHHHHcTTccEEccEEEEcccTTHHHHHHHHHHTTccEEEEcccccccHHHHHHHHHHHHHHcTHHHTcEEEEEEEccHHHHHHHHHTTccEEEEcccccTTcHHHHHccccccHHHHHHHHHHHcTTcHHHHHTcccEEEEEcccccHHHHHHHHHTTccEEEEcTTTTTcTTccccEEEccccEEEcEEccccHHHHHHHccccccEEccccHHHHHHHHHHHHHHHHHHHTcccHHHHHHcccEEccc DISOP:02AL 311-317| PSIPRED cEEEEEEccEEEEEccccccEEEEcccEEEcHHHccEEEEEccEEEEccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHccccEEEEccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEccccHHHHcccccccccccccccHHEEccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHccEEEEcc //