[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56637.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  493/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->129 2gemA PDBj 1e-14 34.4 %
:RPS:PDB   3->194 2a6aA PDBj 1e-18 22.0 %
:RPS:SCOP  3->109 1okjA1  c.55.1.9 * 4e-17 33.3 %
:RPS:SCOP  111->194 1okjA2  c.55.1.9 * 5e-08 28.6 %
:HMM:SCOP  2->112 1okjA1 c.55.1.9 * 4.2e-24 42.5 %
:HMM:SCOP  110->204 1okjA2 c.55.1.9 * 1.9e-18 36.8 %
:RPS:PFM   39->115 PF00814 * Peptidase_M22 1e-13 54.5 %
:HMM:PFM   36->140 PF00814 * Peptidase_M22 1.6e-28 40.0 105/268  
:BLT:SWISS 39->183 Y378_MYCLE 6e-26 46.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56637.1 GT:GENE AAZ56637.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3075038..3075733) GB:FROM 3075038 GB:TO 3075733 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56637.1 GB:DB_XREF GI:71916735 LENGTH 231 SQ:AASEQ MLLLAFDTATPAVTTALCESGPDGVRVRAARTTVDARRHGELLTPQIRTVVADVGVDLEDVTHIAVGIGPGPYTGLRVGLATAHALAEALGVPCVGVATLDALAWASGRTTPFIAATDARRKEVFWARYTDAATRVGDIAVNRPADVDTAGLPVIGHGAHLYADVFGQDPEAAEPLYPTAAALGEFAVRALRDGTPLPEPRPLYLRRPDAQIPGAPKKVRQPTAAELGRSR GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 39->183|Y378_MYCLE|6e-26|46.0|139/359| SEG 25->38|vrvraarttvdarr| SEG 196->208|plpeprplylrrp| BL:PDB:NREP 1 BL:PDB:REP 1->129|2gemA|1e-14|34.4|122/216| RP:PDB:NREP 1 RP:PDB:REP 3->194|2a6aA|1e-18|22.0|173/191| RP:PFM:NREP 1 RP:PFM:REP 39->115|PF00814|1e-13|54.5|77/260|Peptidase_M22| HM:PFM:NREP 1 HM:PFM:REP 36->140|PF00814|1.6e-28|40.0|105/268|Peptidase_M22| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00814|IPR000905| GO:PFM GO:0006508|"GO:proteolysis"|PF00814|IPR000905| RP:SCP:NREP 2 RP:SCP:REP 3->109|1okjA1|4e-17|33.3|102/106|c.55.1.9| RP:SCP:REP 111->194|1okjA2|5e-08|28.6|84/110|c.55.1.9| HM:SCP:REP 2->112|1okjA1|4.2e-24|42.5|106/0|c.55.1.9|1/1|Actin-like ATPase domain| HM:SCP:REP 110->204|1okjA2|1.9e-18|36.8|95/110|c.55.1.9|1/1|Actin-like ATPase domain| OP:NHOMO 494 OP:NHOMOORG 494 OP:PATTERN -------------------------------------------------------------------- -11-111111111111111-11111111111111111111111111111111111111--111111111111---1---1111----------1--1----1111111-1--------------1--1-----1--111-111111-------------------------------------111---1--11111111111111111--11--111111-1111111111-----------------11---1-1--1--11----111---1---111111111111111111111111111111111-11--111---11111--------1-111111-1-1-1-1-111111111111-11111-1--1-111-11111111111111111111111111111-11-11-11----1--111-111--11--1-11-----1----------------1-----------------------------------1----111111-----1111------1-1---111-----1----------111-11-11111111111---1111-----------1-1-11-1------11-------------------------111111-1111-111111111111111111111--1-1-1-----111111-1111111111-111111111111111111111111111-111111111111111-11111111-111111111111-111-1-111111-1111111111111111---------1--11111111111111111111---------111111111111111---1-1----1111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 77.1 SQ:SECSTR cEEEEEEcccccEEEEEEETTE####EEEEEEEcccGGGGGHHHHHHHHHHHHHTccGGGccEEEEEcccccHHHHHHHHHHHHHHHGGGTccEEEEcHHHHHHTcHcccEEEEEEEEccTTEEEEEEEEEcccEEEEEEEEEHHHHHHHH############HHHcccEEEEccccccHHHHHHHHHHHHHTT##################################### DISOP:02AL 219-231| PSIPRED cEEEEEEccccHHEEEEEEccccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHcccHHHccEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHccccccEEEEEEccccEEEEEEEEccccEEcHHHHHHHHcccccccEEEccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccEEccccccccccccccccccccccccccc //