[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56642.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56642.1 GT:GENE AAZ56642.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3081970..3082461 GB:FROM 3081970 GB:TO 3082461 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56642.1 GB:DB_XREF GI:71916740 LENGTH 163 SQ:AASEQ MTYTDDRVDSGLTDRVSLLQNAMHKLGADVIRLQTQLSEIATAAPPRSQERAPASQFIFNLSRDEYRGELAALVSWVNDFLIPVYAGPVTRWCPAWWEHHEAVGRLHALRLSYLELTDTTISGASGPGIWHRDHLDPVLDRLFAPDGPFVNCLGPAGHRPKDS GT:EXON 1|1-163:0| TM:NTM 1 TM:REGION 68->90| OP:NHOMO 12 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3--1------------112------------12-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 35-56, 154-163| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHccccccccccccc //