[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56646.1
DDBJ      :             SSU ribosomal protein S9P
Swiss-Prot:RS9_THEFY    RecName: Full=30S ribosomal protein S9;

Homologs  Archaea  0/68 : Bacteria  724/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->169 3bbnI PDBj 2e-17 38.7 %
:RPS:PDB   46->169 3bbnI PDBj 6e-26 38.2 %
:RPS:SCOP  46->169 1fjgI  d.14.1.1 * 6e-27 35.0 %
:HMM:SCOP  42->169 1fjgI_ d.14.1.1 * 1.6e-45 60.6 %
:RPS:PFM   61->169 PF00380 * Ribosomal_S9 1e-16 43.5 %
:HMM:PFM   48->169 PF00380 * Ribosomal_S9 8e-48 54.5 121/121  
:BLT:SWISS 1->169 RS9_THEFY 2e-61 100.0 %
:PROS 107->125|PS00360|RIBOSOMAL_S9
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56646.1 GT:GENE AAZ56646.1 GT:PRODUCT SSU ribosomal protein S9P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3087508..3088017) GB:FROM 3087508 GB:TO 3088017 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S9P GB:PROTEIN_ID AAZ56646.1 GB:DB_XREF GI:71916744 InterPro:IPR000754 LENGTH 169 SQ:AASEQ MVEPTGIEDVQEYDENSEEYPAEYTTETPETVGETYIPTAVGPSLGTGRRKTAVARVRVVPGTGEWKINGKSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHGLARALAAMDPEHNRPPLKKAGFLTRDARKVERKKAGLKKARKAPQYSKR GT:EXON 1|1-169:0| SW:ID RS9_THEFY SW:DE RecName: Full=30S ribosomal protein S9; SW:GN Name=rpsI; OrderedLocusNames=Tfu_2613; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->169|RS9_THEFY|2e-61|100.0|169/169| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 107->125|PS00360|RIBOSOMAL_S9|PDOC00311| SEG 18->31|eeypaeyttetpet| SEG 49->60|rrktavarvrvv| SEG 114->127|agalrhglaralaa| SEG 152->163|rkkaglkkarka| BL:PDB:NREP 1 BL:PDB:REP 45->169|3bbnI|2e-17|38.7|124/127| RP:PDB:NREP 1 RP:PDB:REP 46->169|3bbnI|6e-26|38.2|123/127| RP:PFM:NREP 1 RP:PFM:REP 61->169|PF00380|1e-16|43.5|108/121|Ribosomal_S9| HM:PFM:NREP 1 HM:PFM:REP 48->169|PF00380|8e-48|54.5|121/121|Ribosomal_S9| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00380|IPR000754| GO:PFM GO:0005622|"GO:intracellular"|PF00380|IPR000754| GO:PFM GO:0005840|"GO:ribosome"|PF00380|IPR000754| GO:PFM GO:0006412|"GO:translation"|PF00380|IPR000754| RP:SCP:NREP 1 RP:SCP:REP 46->169|1fjgI|6e-27|35.0|123/127|d.14.1.1| HM:SCP:REP 42->169|1fjgI_|1.6e-45|60.6|127/127|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 766 OP:NHOMOORG 753 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-111111111111111111111111111111111111111111111111111111111111111-----111111111---1---1--1--11111111--1111-------------1111---1111111111111111111111-111111111111111111-11--111111111111111111111111111-1111111111111-1-1111111111111111111111111111111111111-111-11111111111111111111111111111111111111-11111111111111111111111111111111111111111111-11211111111-11-1111-11111111111111111111111111111-11111111111111111111111111111111111111111111111111111-111------------11--------------11111111111111111111111111111111111111111111111111-11111-11-11-11111111111111-1-111111111111111111111111111--------------------------1111--1111-1111111111111111111111--11---1-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111111111-111111111-1111----1111-------------11111111-11----------------11------111-1---1-1-11---11---1----------11111111111111-- ------1--------------------------------------------------------11-------1-1-1---111111---------------------------------------------------------------------------------------1-----6111-12243-11-1-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 74.0 SQ:SECSTR ############################################ccccEETTEEEEEEEEEccccEEETTEEHHHHccccGGGTTTcHHHHTTTcTTTEEEEEEEEcccHHHHHHHHHHHHHHHTTTccGGEGcHHHHTTTcccccccccccccTTcccTTcccccccc DISOP:02AL 1-3, 23-32, 151-159| PSIPRED ccccccccccccccccccccHHEEEHHcHHccccEEccccEEEEEEEcEEEEEEEEEEEEEccEEEEEccEEHHHHHccHHHHHHHHHHHHHHcccccEEEEEEEEEccEEHHHHHHHHHHHHHHHHHcHHcccHHHHHcccEEEcccccccccccccccccccccccc //