[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56647.1
DDBJ      :             LSU ribosomal protein L13P
Swiss-Prot:RL13_THEFY   RecName: Full=50S ribosomal protein L13;

Homologs  Archaea  16/68 : Bacteria  909/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.21.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->137 2j01N PDBj 9e-47 60.7 %
:RPS:PDB   5->138 3d5bN PDBj 6e-44 59.0 %
:RPS:SCOP  1->137 1vs6J1  c.21.1.1 * 8e-59 56.2 %
:HMM:SCOP  15->142 1j3aA_ c.21.1.1 * 3.8e-47 61.2 %
:RPS:PFM   15->137 PF00572 * Ribosomal_L13 2e-38 68.3 %
:HMM:PFM   15->141 PF00572 * Ribosomal_L13 6e-59 66.9 127/128  
:BLT:SWISS 1->149 RL13_THEFY 4e-85 100.0 %
:PROS 105->127|PS00783|RIBOSOMAL_L13

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56647.1 GT:GENE AAZ56647.1 GT:PRODUCT LSU ribosomal protein L13P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3088051..3088500) GB:FROM 3088051 GB:TO 3088500 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L13P GB:PROTEIN_ID AAZ56647.1 GB:DB_XREF GI:71916745 InterPro:IPR005822 InterPro:IPR005823 LENGTH 149 SQ:AASEQ MRTFSPKPSDIQRQWHVIDASDVVLGRLASRVATLLRGKHKPYYAPHVDTGDYVIVVNADKVVLTGKKLEQKRAYRHSGYPGGLRSIPYSELMAKNPARAVEKAVKGMLPKNSLGRRMAKKLKVYAGPEHPHQAQKPVPYEITKIKQPA GT:EXON 1|1-149:0| SW:ID RL13_THEFY SW:DE RecName: Full=50S ribosomal protein L13; SW:GN Name=rplM; OrderedLocusNames=Tfu_2614; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|RL13_THEFY|4e-85|100.0|149/149| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 105->127|PS00783|RIBOSOMAL_L13|PDOC00625| BL:PDB:NREP 1 BL:PDB:REP 1->137|2j01N|9e-47|60.7|135/138| RP:PDB:NREP 1 RP:PDB:REP 5->138|3d5bN|6e-44|59.0|134/137| RP:PFM:NREP 1 RP:PFM:REP 15->137|PF00572|2e-38|68.3|123/128|Ribosomal_L13| HM:PFM:NREP 1 HM:PFM:REP 15->141|PF00572|6e-59|66.9|127/128|Ribosomal_L13| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00572|IPR005822| GO:PFM GO:0005622|"GO:intracellular"|PF00572|IPR005822| GO:PFM GO:0005840|"GO:ribosome"|PF00572|IPR005822| GO:PFM GO:0006412|"GO:translation"|PF00572|IPR005822| RP:SCP:NREP 1 RP:SCP:REP 1->137|1vs6J1|8e-59|56.2|137/140|c.21.1.1| HM:SCP:REP 15->142|1j3aA_|3.8e-47|61.2|116/142|c.21.1.1|1/1|Ribosomal protein L13| OP:NHOMO 1153 OP:NHOMOORG 1091 OP:PATTERN -------11111111--------1------------------------1111111------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-31--211-111-11111111111-1111-111111111111111111111-1111111111111111-111111111111-11111111111111112-141-111-121--111112-1-121-1-11-1-1-11111-111-11---1211-1211111111-112222M2222242541321121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 95.3 SQ:SECSTR cccccccccccccccEEEccTTccHHHHHHHHHHHHTGGGcTTccTTTcccccEEEcccTTccccccTTTTcEEEcccccTTcccEEEHHHHHHccTHHHHHHHHHHHccccHHHHHHHHTEEEcccccccccccccEcccc####### DISOP:02AL 147-149| PSIPRED cccccccHHHccEEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccEEEEcccHHHHEEEEEccccccccccccHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHcccccccccHHHcccccccccccccccc //