[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56650.1
DDBJ      :             LSU ribosomal protein L17P
Swiss-Prot:RL17_THEFY   RecName: Full=50S ribosomal protein L17;

Homologs  Archaea  0/68 : Bacteria  902/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->116 3bboP PDBj 3e-30 54.1 %
:RPS:PDB   1->116 3bboP PDBj 2e-47 52.6 %
:RPS:SCOP  15->117 1gd8A  d.188.1.1 * 3e-42 53.4 %
:HMM:SCOP  14->117 1gd8A_ d.188.1.1 * 4.5e-44 61.5 %
:RPS:PFM   20->116 PF01196 * Ribosomal_L17 2e-28 68.0 %
:HMM:PFM   20->116 PF01196 * Ribosomal_L17 2.1e-44 59.8 97/97  
:HMM:PFM   86->166 PF10156 * Med17 0.0004 24.3 70/467  
:BLT:SWISS 1->172 RL17_THEFY 9e-86 100.0 %
:PROS 34->56|PS01167|RIBOSOMAL_L17
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56650.1 GT:GENE AAZ56650.1 GT:PRODUCT LSU ribosomal protein L17P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3092117..3092635) GB:FROM 3092117 GB:TO 3092635 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L17P GB:PROTEIN_ID AAZ56650.1 GB:DB_XREF GI:71916748 InterPro:IPR000456 LENGTH 172 SQ:AASEQ MPTPTKGPRLGGGPAHERLMLANLATALFRHGRIKTTEAKAKRLRPYAEKLITLGKRGDLHARRQVLTKIRDKAVVHELFTEIGPRYENRNGGYTRITKIGNRKGDNAPMAVIELVEALNKPATGSKRAQTEEAASQEPAAEAGKQPAEGATSVQTAEAADASQAEGEAEEK GT:EXON 1|1-172:0| SW:ID RL17_THEFY SW:DE RecName: Full=50S ribosomal protein L17; SW:GN Name=rplQ; OrderedLocusNames=Tfu_2617; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->172|RL17_THEFY|9e-86|100.0|172/172| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 34->56|PS01167|RIBOSOMAL_L17|PDOC00897| SEG 129->143|aqteeaasqepaaea| BL:PDB:NREP 1 BL:PDB:REP 6->116|3bboP|3e-30|54.1|111/116| RP:PDB:NREP 1 RP:PDB:REP 1->116|3bboP|2e-47|52.6|116/116| RP:PFM:NREP 1 RP:PFM:REP 20->116|PF01196|2e-28|68.0|97/97|Ribosomal_L17| HM:PFM:NREP 2 HM:PFM:REP 20->116|PF01196|2.1e-44|59.8|97/97|Ribosomal_L17| HM:PFM:REP 86->166|PF10156|0.0004|24.3|70/467|Med17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 15->117|1gd8A|3e-42|53.4|103/105|d.188.1.1| HM:SCP:REP 14->117|1gd8A_|4.5e-44|61.5|104/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 1105 OP:NHOMOORG 1050 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-111-1111111111111111111111-111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111--1111 11--111-1----11111-111111111111-11111111111111111-1----1111111---111--11-11111111111-111-1111111----121112--31111111-2-1111-11111151-111-11-1111111-1-11-111111--------------112222I2112243441322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 70.3 SQ:SECSTR ccTTcccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHcTTHHHHHHHTTcccTTHHHHHTTccGGGGcccccccEEccccccccccccccEEEEEcccccc################################################### DISOP:02AL 1-5, 7-16, 121-172| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccc //