[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56655.1
DDBJ      :             bacterial translation initiation factor 1 (bIF-1)
Swiss-Prot:IF1_THEFY    RecName: Full=Translation initiation factor IF-1;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->71 1hr0W PDBj 5e-25 71.4 %
:RPS:PDB   2->73 1ah9A PDBj 1e-19 69.0 %
:RPS:SCOP  1->72 1jt8A  b.40.4.5 * 5e-20 25.7 %
:HMM:SCOP  2->72 1hr0W_ b.40.4.5 * 4.5e-30 62.0 %
:RPS:PFM   8->71 PF01176 * eIF-1a 5e-23 76.6 %
:HMM:PFM   8->71 PF01176 * eIF-1a 1.6e-32 52.4 63/65  
:BLT:SWISS 1->73 IF1_THEFY 1e-38 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56655.1 GT:GENE AAZ56655.1 GT:PRODUCT bacterial translation initiation factor 1 (bIF-1) GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3095097..3095318) GB:FROM 3095097 GB:TO 3095318 GB:DIRECTION - GB:PRODUCT bacterial translation initiation factor 1 (bIF-1) GB:PROTEIN_ID AAZ56655.1 GB:DB_XREF GI:71916753 InterPro:IPR003029 InterPro:IPR004368 InterPro:IPR006196 LENGTH 73 SQ:AASEQ MAKKDGAIEIEGTVIESLPNAMFRVELDNGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK GT:EXON 1|1-73:0| SW:ID IF1_THEFY SW:DE RecName: Full=Translation initiation factor IF-1; SW:GN Name=infA; OrderedLocusNames=Tfu_2622; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->73|IF1_THEFY|1e-38|100.0|73/73| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 2->71|1hr0W|5e-25|71.4|70/71| RP:PDB:NREP 1 RP:PDB:REP 2->73|1ah9A|1e-19|69.0|71/71| RP:PFM:NREP 1 RP:PFM:REP 8->71|PF01176|5e-23|76.6|64/66|eIF-1a| HM:PFM:NREP 1 HM:PFM:REP 8->71|PF01176|1.6e-32|52.4|63/65|eIF-1a| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01176|IPR006196| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF01176|IPR006196| GO:PFM GO:0006413|"GO:translational initiation"|PF01176|IPR006196| RP:SCP:NREP 1 RP:SCP:REP 1->72|1jt8A|5e-20|25.7|70/102|b.40.4.5| HM:SCP:REP 2->72|1hr0W_|4.5e-30|62.0|71/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 988 OP:NHOMOORG 907 OP:PATTERN -------------------------------------------------------------------- 1121211111111111111-11111111111111111111111111111111111111111111111211111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1112111111111111111111111111111211111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111111111--111111111111111111111222122222233232321112222222221222333312222212332121111112222221-1111111122211111112112222-11111111122221111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111112111111111111111111-1111111---1-11111111111111-11121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1---2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 100.0 SQ:SECSTR cccccccEEccEEEEEEccccEEEEEETTccEEEEEEcccGGGTTccccTTcEEccEEccccTTEEEEccccc DISOP:02AL 1-3| PSIPRED ccccccEEEEEEEEEEcccccEEEEEEccccEEEEEEccEEEEEEEEEEEccEEEEEEccccccccEEEEEEc //