[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56663.1
DDBJ      :             LSU ribosomal protein L18P
Swiss-Prot:RL18_THEFY   RecName: Full=50S ribosomal protein L18;

Homologs  Archaea  0/68 : Bacteria  877/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->128 1ovyA PDBj 2e-26 58.8 %
:RPS:PDB   32->128 3bboQ PDBj 4e-29 56.7 %
:RPS:SCOP  35->128 1vs6O1  c.55.4.1 * 2e-30 46.8 %
:HMM:SCOP  32->128 1ovyA_ c.55.4.1 * 1.6e-39 62.9 %
:RPS:PFM   32->128 PF00861 * Ribosomal_L18p 2e-18 57.7 %
:HMM:PFM   17->128 PF00861 * Ribosomal_L18p 3.9e-43 51.8 112/119  
:BLT:SWISS 1->128 RL18_THEFY 2e-52 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56663.1 GT:GENE AAZ56663.1 GT:PRODUCT LSU ribosomal protein L18P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3100442..3100828) GB:FROM 3100442 GB:TO 3100828 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L18P GB:PROTEIN_ID AAZ56663.1 GB:DB_XREF GI:71916761 InterPro:IPR004389 InterPro:IPR005484 LENGTH 128 SQ:AASEQ MAKRSSLTRRGVSPRAAARARRHMRVRKKVRGTPERPRLVVTRSLKHIVAQIVDDTKGHTLVSASTLEASIRGEEGRKTEKSHLVGKVLAERAKAAGITAVVFDRAGYRYHGRVAALANGAREGGLEF GT:EXON 1|1-128:0| SW:ID RL18_THEFY SW:DE RecName: Full=50S ribosomal protein L18; SW:GN Name=rplR; OrderedLocusNames=Tfu_2630; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->128|RL18_THEFY|2e-52|100.0|128/128| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 9->31|rrgvspraaararrhmrvrkkvr| BL:PDB:NREP 1 BL:PDB:REP 32->128|1ovyA|2e-26|58.8|97/97| RP:PDB:NREP 1 RP:PDB:REP 32->128|3bboQ|4e-29|56.7|97/122| RP:PFM:NREP 1 RP:PFM:REP 32->128|PF00861|2e-18|57.7|97/118|Ribosomal_L18p| HM:PFM:NREP 1 HM:PFM:REP 17->128|PF00861|3.9e-43|51.8|112/119|Ribosomal_L18p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00861|IPR005484| GO:PFM GO:0005622|"GO:intracellular"|PF00861|IPR005484| GO:PFM GO:0005840|"GO:ribosome"|PF00861|IPR005484| GO:PFM GO:0006412|"GO:translation"|PF00861|IPR005484| RP:SCP:NREP 1 RP:SCP:REP 35->128|1vs6O1|2e-30|46.8|94/117|c.55.4.1| HM:SCP:REP 32->128|1ovyA_|1.6e-39|62.9|97/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 908 OP:NHOMOORG 898 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111--1-------111111111111111111111111111111111111111111111111111111111111111111111111-1-11-111111111111111111111111111111111-1-111111111111111--11-----1111111111-11111111-11111111111111111111-1111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111112111111111111111111-111-1-----111-1111111111111111-1 11------1---------------------------------------------------------------------------------------------------2------------------------------------------------------1-----------1111-111124132-11------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 75.8 SQ:SECSTR ###############################GcccccccEEEEccccEEEEEEccTTccEEEEEEHHHHHHHHccTTcHHHHHHHHHHcccHHHHTccccccccccccccccTTHHHHHHHTTTTccc DISOP:02AL 1-18| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEEEccccEEEEEEEcccHHHHccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccc //