[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56664.1
DDBJ      :             LSU ribosomal protein L6P
Swiss-Prot:RL6_THEFY    RecName: Full=50S ribosomal protein L6;

Homologs  Archaea  8/68 : Bacteria  909/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
d.141.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->177 2hguH PDBj 1e-46 51.7 %
:RPS:PDB   1->178 3bboI PDBj 4e-51 40.4 %
:RPS:SCOP  8->82 1rl6A1  d.141.1.1 * 2e-18 42.7 %
:RPS:SCOP  83->170 1rl6A2  d.141.1.1 * 1e-34 53.4 %
:HMM:SCOP  5->82 1ffk11 d.141.1.1 * 5e-20 44.9 %
:HMM:SCOP  83->171 1rl6A2 d.141.1.1 * 3.2e-31 58.4 %
:RPS:PFM   92->164 PF00347 * Ribosomal_L6 1e-05 47.1 %
:HMM:PFM   11->82 PF00347 * Ribosomal_L6 7.9e-23 45.8 72/77  
:HMM:PFM   91->164 PF00347 * Ribosomal_L6 6.1e-25 40.8 71/77  
:BLT:SWISS 1->178 RL6_THEFY 4e-91 100.0 %
:PROS 154->162|PS00525|RIBOSOMAL_L6_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56664.1 GT:GENE AAZ56664.1 GT:PRODUCT LSU ribosomal protein L6P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3100831..3101367) GB:FROM 3100831 GB:TO 3101367 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L6P GB:PROTEIN_ID AAZ56664.1 GB:DB_XREF GI:71916762 InterPro:IPR000702 InterPro:IPR002358 LENGTH 178 SQ:AASEQ MSRIGRQPISVPKGVEVTIDGKDVKVKGPKGELKHTVPPSITVTLEDGQVKVSRADDRPQTRSLHGLTRSLIANLIEGTSKGYTKTLEISGVGYRVQAKGRNLEFSLGYSHPIVVEPPEGITFRVEKPTLLHVEGIDKQKVGQVAADIRSLRKPDPYKAKGIRYQGERIRRKAGKAGK GT:EXON 1|1-178:0| SW:ID RL6_THEFY SW:DE RecName: Full=50S ribosomal protein L6; SW:GN Name=rplF; OrderedLocusNames=Tfu_2631; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|RL6_THEFY|4e-91|100.0|178/178| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 154->162|PS00525|RIBOSOMAL_L6_1|PDOC00454| SEG 20->31|dgkdvkvkgpkg| BL:PDB:NREP 1 BL:PDB:REP 4->177|2hguH|1e-46|51.7|174/174| RP:PDB:NREP 1 RP:PDB:REP 1->178|3bboI|4e-51|40.4|178/182| RP:PFM:NREP 1 RP:PFM:REP 92->164|PF00347|1e-05|47.1|68/74|Ribosomal_L6| HM:PFM:NREP 2 HM:PFM:REP 11->82|PF00347|7.9e-23|45.8|72/77|Ribosomal_L6| HM:PFM:REP 91->164|PF00347|6.1e-25|40.8|71/77|Ribosomal_L6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| RP:SCP:NREP 2 RP:SCP:REP 8->82|1rl6A1|2e-18|42.7|75/75|d.141.1.1| RP:SCP:REP 83->170|1rl6A2|1e-34|53.4|88/89|d.141.1.1| HM:SCP:REP 5->82|1ffk11|5e-20|44.9|78/79|d.141.1.1|1/1|Ribosomal protein L6| HM:SCP:REP 83->171|1rl6A2|3.2e-31|58.4|89/89|d.141.1.1|1/1|Ribosomal protein L6| OP:NHOMO 1057 OP:NHOMOORG 1019 OP:PATTERN -----------------------------------11----1----1-------11---11------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------1111-111111111-111111111-111111111-1111111-1111---111111-11-1111111111111111-121-1111111111111--2------------------------------------------------------1----------11121H111122465122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 100.0 SQ:SECSTR ccccccccccccTTccEEEcccEEEEccccccEEEEcccccEEEcccccEEEEcccccTTHHHHHHHHTTTTTHHHHHTTTcEEEcEEcccTTccEEEcccEEEEcccccccEEEEccccEEEEcccTTccEEEEcccHHHHHHHHHTTccccccTTTccccEETTcccccccccccc DISOP:02AL 176-178| PSIPRED ccccccEEEEccccEEEEEEccEEEEEEccEEEEEEEcccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEccEEEEEEcccEEEEEEcccccEEEEccccEEEEEEccHHHHHHHHHHHHccccccccccccEEEcccEEEEEcccccc //