[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56668.1
DDBJ      :             LSU ribosomal protein L24P
Swiss-Prot:RL24_THEFY   RecName: Full=50S ribosomal protein L24;

Homologs  Archaea  0/68 : Bacteria  863/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 1vs6U PDBj 2e-21 54.1 %
:RPS:PDB   1->101 3bboW PDBj 7e-26 39.0 %
:RPS:SCOP  1->101 1vs6U1  b.34.5.1 * 1e-21 53.5 %
:HMM:SCOP  2->100 2gyaS1 b.34.5.1 * 5.9e-30 60.8 %
:HMM:PFM   5->36 PF00467 * KOW 8.7e-11 50.0 32/32  
:BLT:SWISS 1->101 RL24_THEFY 1e-53 100.0 %
:PROS 6->23|PS01108|RIBOSOMAL_L24

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56668.1 GT:GENE AAZ56668.1 GT:PRODUCT LSU ribosomal protein L24P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3102789..3103094) GB:FROM 3102789 GB:TO 3103094 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L24P GB:PROTEIN_ID AAZ56668.1 GB:DB_XREF GI:71916766 InterPro:IPR003256 InterPro:IPR005825 InterPro:IPR006646 LENGTH 101 SQ:AASEQ MKIKKGDEVIVIAGKDKGATGKVKKALPKEQRVIVEGVNLIKKHKKANQAGGQQGEVVTLEAPIHVSNVALLEDGRPTRVGYRFKEDGTKVRISRRTGKEI GT:EXON 1|1-101:0| SW:ID RL24_THEFY SW:DE RecName: Full=50S ribosomal protein L24; SW:GN Name=rplX; OrderedLocusNames=Tfu_2635; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|RL24_THEFY|1e-53|100.0|101/101| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 6->23|PS01108|RIBOSOMAL_L24|PDOC00852| BL:PDB:NREP 1 BL:PDB:REP 2->101|1vs6U|2e-21|54.1|98/102| RP:PDB:NREP 1 RP:PDB:REP 1->101|3bboW|7e-26|39.0|100/110| HM:PFM:NREP 1 HM:PFM:REP 5->36|PF00467|8.7e-11|50.0|32/32|KOW| RP:SCP:NREP 1 RP:SCP:REP 1->101|1vs6U1|1e-21|53.5|99/102|b.34.5.1| HM:SCP:REP 2->100|2gyaS1|5.9e-30|60.8|97/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 976 OP:NHOMOORG 929 OP:PATTERN -------------------------------------------------------------------- -1-1111111111111111-1111111111111111111111111111111111111111111111111111111111111111---1111111111--111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-1-11-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111-1111111121111111111111111111111111111-11111111111111111111111111111111111111111111111111111111---1111111111-1111111111-1---11111111111111111111111111111111111111111111-111111111111111111-------111111-11-11111111111111111111-11--1111111111111111-1-111111--1111111111111111111111111111111111-11111-1-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111-1--1111111111111111111111111111111- 21---1--1----------------------------------------------------------------------------------------------1-----1211111-11--111---1-342-1111----1-11-1---1--11-111--111-1-111---111212P121113332-2211-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEcccccTTccccccccccccccccccccccccccccEccccccccccccccccccGGGEEEcccccccccccccccccccccccccccccc DISOP:02AL 46-57| PSIPRED cEEEEccEEEEEEccccccEEEEEEEEccccEEEEEcccEEEEEEcccccccccccEEEEEcccccccEEEEEcccccEEEEEEEEcccEEEEEEcccccc //