[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56672.1
DDBJ      :             LSU ribosomal protein L16P
Swiss-Prot:RL16_THEFY   RecName: Full=50S ribosomal protein L16;

Homologs  Archaea  0/68 : Bacteria  910/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
d.41.4
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->136 1vs9K PDBj 4e-46 62.5 %
:RPS:PDB   1->134 3bboO PDBj 2e-44 52.2 %
:RPS:SCOP  1->135 1vs6M1  d.41.4.2 * 4e-45 50.0 %
:HMM:SCOP  3->134 2gyaK1 d.41.4.2 * 1.3e-54 58.8 %
:RPS:PFM   4->132 PF00252 * Ribosomal_L16 8e-32 51.9 %
:HMM:PFM   4->133 PF00252 * Ribosomal_L16 1e-52 52.3 130/133  
:BLT:SWISS 1->138 RL16_THEFY 2e-79 100.0 %
:PROS 59->70|PS00586|RIBOSOMAL_L16_1
:PROS 82->93|PS00701|RIBOSOMAL_L16_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56672.1 GT:GENE AAZ56672.1 GT:PRODUCT LSU ribosomal protein L16P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3104119..3104535) GB:FROM 3104119 GB:TO 3104535 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L16P GB:PROTEIN_ID AAZ56672.1 GB:DB_XREF GI:71916770 InterPro:IPR000114 LENGTH 138 SQ:AASEQ MLIPRKVKHRKQHHPSLRGRAKGGTSVHFGEYGIQALESAYVTNRQIEAARIAMTRHIRRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVAPVKAGRVMFELAGVPEPVAKEALRRAIHKLPMKCKVVKREAGE GT:EXON 1|1-138:0| SW:ID RL16_THEFY SW:DE RecName: Full=50S ribosomal protein L16; SW:GN Name=rplP; OrderedLocusNames=Tfu_2639; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->138|RL16_THEFY|2e-79|100.0|138/138| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 59->70|PS00586|RIBOSOMAL_L16_1|PDOC00506| PROS 82->93|PS00701|RIBOSOMAL_L16_2|PDOC00506| BL:PDB:NREP 1 BL:PDB:REP 1->136|1vs9K|4e-46|62.5|136/137| RP:PDB:NREP 1 RP:PDB:REP 1->134|3bboO|2e-44|52.2|134/135| RP:PFM:NREP 1 RP:PFM:REP 4->132|PF00252|8e-32|51.9|129/130|Ribosomal_L16| HM:PFM:NREP 1 HM:PFM:REP 4->133|PF00252|1e-52|52.3|130/133|Ribosomal_L16| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00252|IPR016180| GO:PFM GO:0005840|"GO:ribosome"|PF00252|IPR016180| GO:PFM GO:0006412|"GO:translation"|PF00252|IPR016180| RP:SCP:NREP 1 RP:SCP:REP 1->135|1vs6M1|4e-45|50.0|134/136|d.41.4.2| HM:SCP:REP 3->134|2gyaK1|1.3e-54|58.8|131/0|d.41.4.2|1/1|Ribosomal protein L16p/L10e| OP:NHOMO 1016 OP:NHOMOORG 998 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -1----------1111---1111111111----111-111-11-------------1-----111111-11111-1111111111111-121-11111111-1112---------3-11-------1--141-11-111---1----------1-1-----------------1-211----1--12-4-13------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 100.0 SQ:SECSTR cccccccccccccccccccTTccccccccccEEEEEcccccccHHHHHHHHHHHHHTTccccccccccccccccccccccccccccccccccccccccTTcEEEEEccccTTHHHHHHHHHHHHccccEEEEccTccc DISOP:02AL 1-2, 80-84, 137-138| PSIPRED ccccccccEEcccccccccccccccEEEEccEEEEEccccEEcHHHHHHHHHHHHHHHccccEEEEEEcccccEEEcccccccccccccccEEEEEEcccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccc //