[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56677.1
DDBJ      :             LSU ribosomal protein L23P
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  637/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:96 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->92 2zjrQ PDBj 2e-17 47.5 %
:RPS:PDB   12->88 3bboV PDBj 6e-17 29.3 %
:RPS:SCOP  12->95 1vs6T1  d.12.1.1 * 2e-20 39.3 %
:HMM:SCOP  3->95 1n88A_ d.12.1.1 * 6.4e-31 50.0 %
:RPS:PFM   12->95 PF00276 * Ribosomal_L23 6e-18 59.5 %
:HMM:PFM   8->94 PF00276 * Ribosomal_L23 1.7e-30 50.6 87/92  
:BLT:SWISS 13->94 RL23_PROAC 1e-33 78.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56677.1 GT:GENE AAZ56677.1 GT:PRODUCT LSU ribosomal protein L23P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3106984..3107274) GB:FROM 3106984 GB:TO 3107274 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L23P GB:PROTEIN_ID AAZ56677.1 GB:DB_XREF GI:71916775 InterPro:IPR001014 LENGTH 96 SQ:AASEQ MRIPDPRDIIIKPVISEKSYGLLDQNKYTFLVHPEANKTQIKMAVEQIFDVKVTSVNTINRKGKRKRTRFGYGKRPDTKRAIVSLKDGDRIDIFGV GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 13->94|RL23_PROAC|1e-33|78.0|82/102| SEG 2->11|ripdprdiii| BL:PDB:NREP 1 BL:PDB:REP 13->92|2zjrQ|2e-17|47.5|80/93| RP:PDB:NREP 1 RP:PDB:REP 12->88|3bboV|6e-17|29.3|75/85| RP:PFM:NREP 1 RP:PFM:REP 12->95|PF00276|6e-18|59.5|84/91|Ribosomal_L23| HM:PFM:NREP 1 HM:PFM:REP 8->94|PF00276|1.7e-30|50.6|87/92|Ribosomal_L23| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00276|IPR013025| GO:PFM GO:0005622|"GO:intracellular"|PF00276|IPR013025| GO:PFM GO:0005840|"GO:ribosome"|PF00276|IPR013025| GO:PFM GO:0006412|"GO:translation"|PF00276|IPR013025| RP:SCP:NREP 1 RP:SCP:REP 12->95|1vs6T1|2e-20|39.3|84/99|d.12.1.1| HM:SCP:REP 3->95|1n88A_|6.4e-31|50.0|90/96|d.12.1.1|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 640 OP:NHOMOORG 637 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111--1--111111-1--------------1--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-1111-111----111-111-11111111111-111111111111111111111111-111111111-1-11111111111111111-1111-1111111111111111111111-11111----21111111111111111111111111111-11111111111111111111111111111111-1--1-111111111111111-1------------------------11-11111111-----111111111111111111111111111111111-1111-1111-11-111111--1----11-11-111-1-1-111----11111-111111111-1-------------------------11--1111111111-------------11-11--1111---------111------------------------------------1111----------------1-------1-111111111111---111111----11111---------------11111--1111111111111111111111111111111111111111111111---------------11-111211--------1111-111-1-11---11111--11---1-1--1-11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 87.5 SQ:SECSTR ###########cccccHHHHHHHTccEEccEEcTTccHHHHHHTTTTTccccEEEcccEEETTTEEEccEEEcccTTTcTTTHHHHccccccccc# PSIPRED cccccHHHHHHcccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEccccEEEccccccccccEEEEEEEcccccEEEEEEc //