[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56690.1
DDBJ      :             LSU ribosomal protein L1P
Swiss-Prot:RL1_THEFY    RecName: Full=50S ribosomal protein L1;

Homologs  Archaea  0/68 : Bacteria  908/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
e.24.1
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->227 2hguC PDBj 9e-51 53.5 %
:RPS:PDB   5->227 1ad2A PDBj 7e-61 41.7 %
:RPS:SCOP  5->227 1ad2A  e.24.1.1 * 3e-61 41.7 %
:HMM:SCOP  5->227 1ad2A_ e.24.1.1 * 1.1e-83 53.4 %
:RPS:PFM   15->219 PF00687 * Ribosomal_L1 2e-37 45.0 %
:HMM:PFM   15->220 PF00687 * Ribosomal_L1 1.6e-87 55.3 206/209  
:BLT:SWISS 1->235 RL1_THEFY e-109 100.0 %
:PROS 120->138|PS01199|RIBOSOMAL_L1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56690.1 GT:GENE AAZ56690.1 GT:PRODUCT LSU ribosomal protein L1P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3126421..3127128) GB:FROM 3126421 GB:TO 3127128 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L1P GB:PROTEIN_ID AAZ56690.1 GB:DB_XREF GI:71916788 InterPro:IPR002143 InterPro:IPR005878 LENGTH 235 SQ:AASEQ MKRSKSYRKAAEQIDRTRLYTPAEAVRLAKETSTVKFDATVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFAAGERAEQARAAGADYVGDDDLVERIQQGFLDFDAVVATPDMMGKIGRLGRILGPRGLMPNPKTGTVTMDVAKAVSDIKGGKIEFRVDRHGNLHLIIGKVSFDEQKLLENYLAAVDEVLRLKPSAAKGRYIKKITLTTTMGPGIPVDPNATREAAKAA GT:EXON 1|1-235:0| SW:ID RL1_THEFY SW:DE RecName: Full=50S ribosomal protein L1; SW:GN Name=rplA; OrderedLocusNames=Tfu_2657; SW:KW Complete proteome; Repressor; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding; Translation regulation; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|RL1_THEFY|e-109|100.0|235/235| GO:SWS:NREP 6 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0006417|"GO:regulation of translation"|Translation regulation| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 120->138|PS01199|RIBOSOMAL_L1|PDOC00922| SEG 78->91|aageraeqaraaga| SEG 120->137|mgkigrlgrilgprglmp| BL:PDB:NREP 1 BL:PDB:REP 2->227|2hguC|9e-51|53.5|226/228| RP:PDB:NREP 1 RP:PDB:REP 5->227|1ad2A|7e-61|41.7|223/224| RP:PFM:NREP 1 RP:PFM:REP 15->219|PF00687|2e-37|45.0|202/206|Ribosomal_L1| HM:PFM:NREP 1 HM:PFM:REP 15->220|PF00687|1.6e-87|55.3|206/209|Ribosomal_L1| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF00687|IPR002143| GO:PFM GO:0006396|"GO:RNA processing"|PF00687|IPR002143| RP:SCP:NREP 1 RP:SCP:REP 5->227|1ad2A|3e-61|41.7|223/224|e.24.1.1| HM:SCP:REP 5->227|1ad2A_|1.1e-83|53.4|223/224|e.24.1.1|1/1|Ribosomal protein L1| OP:NHOMO 993 OP:NHOMOORG 945 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111121111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 --------------11---11111-1-------------------------------------1---11----1-----------------------------1-1--3----------------------------------------------------------------1-2222Q1-2223234-32112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 96.2 SQ:SECSTR #ccccccTTTTTcccTTccccHHHHHHHHHTTcccccccEEEEEEEEcccTTcGGGccEEEEEccccccTTccEEEEccTHHHHHHHHTTccEEEcGGGHHHHHTTcccccEEEEcGGHHHHHHHHHHHHHHHTccccTTTTcccccHHHHHHHHHTTEEEEEccTTcEEEEEEEETTccHHHHHHHHHHHHHHHHTTccTTcccccEEEEEEEcTTcccEEEcTTc######## DISOP:02AL 1-4, 6-11, 229-235| PSIPRED ccHHHHHHHHHHHccccccccHHHHHHHHHHccccccccEEEEEEEEEcccccccccEEEEEEcccccccccEEEEEccHHHHHHHHHccccEEcHHHHHHHHHHHcccccEEEEcHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccEEEcHHHHHHHHHcc //