[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56699.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y2666_THEFY  RecName: Full=UPF0336 protein Tfu_2666;

Homologs  Archaea  0/68 : Bacteria  85/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->112 1s9cC PDBj 2e-06 30.6 %
:RPS:PDB   9->151 2bi0A PDBj 2e-15 11.8 %
:RPS:SCOP  49->151 1pn2A1  d.38.1.4 * 7e-21 14.6 %
:HMM:SCOP  7->147 1s9cA2 d.38.1.4 * 1.5e-36 35.5 %
:RPS:PFM   16->110 PF01575 * MaoC_dehydratas 2e-08 38.8 %
:HMM:PFM   7->116 PF01575 * MaoC_dehydratas 3e-09 24.0 104/123  
:BLT:SWISS 1->152 Y2666_THEFY 5e-85 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56699.1 GT:GENE AAZ56699.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3134493..3134951) GB:FROM 3134493 GB:TO 3134951 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56699.1 GB:DB_XREF GI:71916797 LENGTH 152 SQ:AASEQ MAINRDYLGRAYELPEPYEVTRVKIREFADAISDPNPLYRDPAHAKEAGYTDVIAPPTFPIILSMEGAGQAIADPELALDFSRVVHGDQRFRYSRPLQAGDVVTCRTTITDIKSLAGNEMLTLESEIATTAGEHVVTSVTMLVVRGDAPSGT GT:EXON 1|1-152:0| SW:ID Y2666_THEFY SW:DE RecName: Full=UPF0336 protein Tfu_2666; SW:GN OrderedLocusNames=Tfu_2666; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->152|Y2666_THEFY|5e-85|100.0|152/152| BL:PDB:NREP 1 BL:PDB:REP 40->112|1s9cC|2e-06|30.6|72/271| RP:PDB:NREP 1 RP:PDB:REP 9->151|2bi0A|2e-15|11.8|136/327| RP:PFM:NREP 1 RP:PFM:REP 16->110|PF01575|2e-08|38.8|85/116|MaoC_dehydratas| HM:PFM:NREP 1 HM:PFM:REP 7->116|PF01575|3e-09|24.0|104/123|MaoC_dehydratas| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 1 RP:SCP:REP 49->151|1pn2A1|7e-21|14.6|103/148|d.38.1.4| HM:SCP:REP 7->147|1s9cA2|1.5e-36|35.5|138/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 157 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- ----1---------53333-343344323233545434541111111111111111121121111131111------------------------------------------------------------------------------------------------------------------------1--------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--1-----------------------1--------------1-------------------------------------------------------------1--------------------------------212--------------1---1--------------------1----------------------11212------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 97.4 SQ:SECSTR ###cHHTTTcEEcccccEEccHHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHTHHHHHHHHHHHHHTTTTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEEccccTTcccEEEEEcTTccEEEEEEEEEEEccTTccc# DISOP:02AL 149-152| PSIPRED ccccHHHccccccccccEEEcHHHHHHHHHHHcccccccccHHHHHHcccccEEcccHHHHHHHHHHHcccccccccccccEEEEEEccEEEEEcccccccEEEEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEccccccc //