[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56700.1
DDBJ      :             LSU ribosomal protein L33P
Swiss-Prot:RL33_THEFY   RecName: Full=50S ribosomal protein L33;

Homologs  Archaea  0/68 : Bacteria  208/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:54 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->52 3hux6 PDBj 2e-16 68.1 %
:RPS:PDB   3->54 3bbo3 PDBj 4e-12 53.8 %
:RPS:SCOP  3->54 1vs611  g.41.8.6 * 5e-14 36.5 %
:HMM:SCOP  3->54 2gya11 g.41.8.6 * 4.9e-18 53.8 %
:RPS:PFM   7->52 PF00471 * Ribosomal_L33 3e-07 63.0 %
:HMM:PFM   7->54 PF00471 * Ribosomal_L33 2.3e-25 62.5 48/48  
:BLT:SWISS 1->54 RL33_THEFY 2e-30 100.0 %
:PROS 22->41|PS00582|RIBOSOMAL_L33

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56700.1 GT:GENE AAZ56700.1 GT:PRODUCT LSU ribosomal protein L33P GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3135164..3135328) GB:FROM 3135164 GB:TO 3135328 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L33P GB:PROTEIN_ID AAZ56700.1 GB:DB_XREF GI:71916798 InterPro:IPR001705 LENGTH 54 SQ:AASEQ MAATDVRPKITLACQECKHRNYITRKNRRNTPDRLELRKYCPNCRTHREHRETR GT:EXON 1|1-54:0| SW:ID RL33_THEFY SW:DE RecName: Full=50S ribosomal protein L33; SW:GN Name=rpmG; OrderedLocusNames=Tfu_2667; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->54|RL33_THEFY|2e-30|100.0|54/54| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 22->41|PS00582|RIBOSOMAL_L33|PDOC00503| BL:PDB:NREP 1 BL:PDB:REP 6->52|3hux6|2e-16|68.1|47/48| RP:PDB:NREP 1 RP:PDB:REP 3->54|3bbo3|4e-12|53.8|52/65| RP:PFM:NREP 1 RP:PFM:REP 7->52|PF00471|3e-07|63.0|46/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 7->54|PF00471|2.3e-25|62.5|48/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 3->54|1vs611|5e-14|36.5|52/54|g.41.8.6| HM:SCP:REP 3->54|2gya11|4.9e-18|53.8|52/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 265 OP:NHOMOORG 208 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-1111111111111111111111111111------------2211112112111111111111111--------------------------------------------------------111-1-1--11---11-----------------------------1111-1333332223-2222221113332--221112111111-122-22222222222222122221-1----1-----11--111--------------------------------------------------1-1111111111-111-11-1111-111111111111---111-1111--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----111111----11-11-----1-1------111111------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------1-21-1---11--2-------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 96.3 SQ:SECSTR ##ccccccccEEccccTTccccccEEccTTcccccccccccccccccccccccc DISOP:02AL 1-4, 52-54| PSIPRED cccccccEEEEEEEEEcccccEEEEccccccccEEEEEccccccccEEEEEEcc //