[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56709.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  63/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->224 3e8xA PDBj 7e-16 29.6 %
:RPS:SCOP  112->225 1xq6A  c.2.1.2 * 3e-09 17.9 %
:HMM:SCOP  9->219 2fmuA1 c.2.1.2 * 2.4e-37 35.2 %
:HMM:PFM   11->165 PF01370 * Epimerase 3.4e-07 23.7 152/238  
:BLT:SWISS 12->225 YGL3_SCHPO 6e-13 26.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56709.1 GT:GENE AAZ56709.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3150164..3150853 GB:FROM 3150164 GB:TO 3150853 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56709.1 GB:DB_XREF GI:71916807 LENGTH 229 SQ:AASEQ MPRTSLSVMRIVIAGGHGKIALRLARLLAQRGDTPVGLIRNPDHADDVRAAGAEPVVIDLEATTVTQVAEKMMGADAVVFAAGAGPGSGAARKDTVDRAAAILTADAASLVGARRFLMISAMGVDEGPAPDADPVWAAYLRAKKAADDDLRGRSEQLDWTILRPGRLTDDPGTGKVRLAPSGVGRSTISRDDVAAVLVALLDAPGTIGKVLEVVGGETPISEAVAAVSR GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 12->225|YGL3_SCHPO|6e-13|26.8|213/247| SEG 21->31|alrlarllaqr| SEG 74->91|gadavvfaagagpgsgaa| SEG 99->108|aaailtadaa| SEG 191->203|ddvaavlvallda| BL:PDB:NREP 1 BL:PDB:REP 10->224|3e8xA|7e-16|29.6|203/209| HM:PFM:NREP 1 HM:PFM:REP 11->165|PF01370|3.4e-07|23.7|152/238|Epimerase| RP:SCP:NREP 1 RP:SCP:REP 112->225|1xq6A|3e-09|17.9|112/253|c.2.1.2| HM:SCP:REP 9->219|2fmuA1|2.4e-37|35.2|199/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 79 OP:NHOMOORG 75 OP:PATTERN --------------------------2----------------------------------------- ----1------1--111----1--11-----111111111-1--1121111-111111----1-1111111--------------------------------1---------------------------------------------------------------------------------------------------------1111---------1-----1-1------------------------2--------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1----------------------1-------------1------------------------------------------------------------------------------------------1-------------------------------------1------1-1--------------------------11111------------------------------------------------------------------ ---------------11-------------------------------------------------------11------------11----1-1-111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 88.6 SQ:SECSTR #########EEEEETTTcHHHHHHHHHHHHTTcEEEE#EccGGGHHHHHHTTccEEEE###ccTTcccGGGGTTccEEEEcccccTTccHHHHHHTTTHHHHHHHHHHHHHTccEEEEccTTcccGGGccGHH#####HHHHHHHHHHHHHHcc##cEEEEEEEccEEccccccEEEEEccccccc#EEHHHHHHHHHHHTTcGGGTTEEEEEEEEEEEHHHHH##### DISOP:02AL 1-4| PSIPRED cccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHcccccEEEEEEEcccHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccEEEEccccccccEEcHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHc //