Thermobifida fusca YX (tfus0)
Gene : AAZ56710.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56710.1 GT:GENE AAZ56710.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3151014..3151517 GB:FROM 3151014 GB:TO 3151517 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56710.1 GB:DB_XREF GI:71916808 LENGTH 167 SQ:AASEQ MGVTQVVRDSTVVEHAKVAAQQKRRMFVVQLRVNAYDEPSSSVRPGLTRILEGIEEAGWRLDQISYSQDSNGDPAQLCIFRPAEEAKPQAEQEQAAAEQASQPHTGQQQPHTGQQQPYQQDPYANYPYPHGQQGYGQQPYPGYGQQGYGQQPYPYGQQYPGYGQQQW GT:EXON 1|1-167:0| SEG 82->123|paeeakpqaeqeqaaaeqasqphtgqqqphtgqqqpyqqdpy| SEG 126->166|ypyphgqqgygqqpypgygqqgygqqpypygqqypgygqqq| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 68-72, 90-111, 138-167| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //