[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56740.1
DDBJ      :             putative acetoin utilization protein
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  392/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.42.1
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   132->338 1zz0A PDBj 3e-30 36.0 %
:RPS:PDB   7->325 1c3pA PDBj 9e-57 31.4 %
:RPS:SCOP  16->359 1t64A  c.42.1.2 * 1e-65 21.9 %
:HMM:SCOP  3->360 1t64A_ c.42.1.2 * 1.4e-105 38.3 %
:RPS:PFM   22->312 PF00850 * Hist_deacetyl 9e-41 36.1 %
:HMM:PFM   20->317 PF00850 * Hist_deacetyl 5.5e-79 38.6 290/306  
:BLT:SWISS 15->334 ACUC_BACSU 9e-51 36.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56740.1 GT:GENE AAZ56740.1 GT:PRODUCT putative acetoin utilization protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3181125..3182303) GB:FROM 3181125 GB:TO 3182303 GB:DIRECTION - GB:PRODUCT putative acetoin utilization protein GB:PROTEIN_ID AAZ56740.1 GB:DB_XREF GI:71916838 InterPro:IPR000286 InterPro:IPR003085 LENGTH 392 SQ:AASEQ MACSLRIAWNDGLTSYNFGPQHPLAPVRVELTMELCRRLGVFDAPGVSFAPVEPADDALLELVHSRDYIAAVKQAGKTLEPNMKYALGTSDNPVFPDMHEASALVAGASVAAARAVWQGEAEHGANIAGGLHHAMPNKAWGFCVYNDAAVAIAWLLEQGAKRVAYVDVDVHHGDGVQEMFYNDPRVLTISLHESPLTLFPGTGYPEEIGGPDAEGYAVNVALPAGTNDAMWLRAFHAIVPPLLREFQPEVLVTQQGCDTHTLDPLANLTLSIDGQRRTYEALHELAKETAAGRWVLLGGGGYELVQVVPRAWTHLLAEAAGTPIDPETRTPDEWHEFVKERTGEVPPLHMTDGRKADYVPFEAGFDPADAVDRAIRATRAAVFPCHGIDPMM GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 15->334|ACUC_BACSU|9e-51|36.3|314/387| SEG 101->116|asalvagasvaaarav| SEG 166->176|vdvdvhhgdgv| BL:PDB:NREP 1 BL:PDB:REP 132->338|1zz0A|3e-30|36.0|200/367| RP:PDB:NREP 1 RP:PDB:REP 7->325|1c3pA|9e-57|31.4|309/372| RP:PFM:NREP 1 RP:PFM:REP 22->312|PF00850|9e-41|36.1|285/304|Hist_deacetyl| HM:PFM:NREP 1 HM:PFM:REP 20->317|PF00850|5.5e-79|38.6|290/306|Hist_deacetyl| RP:SCP:NREP 1 RP:SCP:REP 16->359|1t64A|1e-65|21.9|334/364|c.42.1.2| HM:SCP:REP 3->360|1t64A_|1.4e-105|38.3|347/364|c.42.1.2|1/1|Arginase/deacetylase| OP:NHOMO 1922 OP:NHOMOORG 638 OP:PATTERN 11121122333333331111111111111121--1-1-------1-223-1111-11111----2--- -121-1---------11--------1----------2111111111111---111111--111-2111111-----------322111---------------1-11-21--------------------------33322111121132221212211111121122222------------2112211--111111111111111111111111111111111------111111111111111111--11----------------------------------------------------------------------1------------------------------111111211-21--11---2113221-----122221111122111111111112-13312211151-211122222211211--2314444325--------2-----12-----------------------------11-2--34333322324144543312444442442322312222122221351312211111221111111-11122-2232121111111112111112-----3122--------------------1---111---23-1221-------1---------------1312-------------------------------------------111--11-----------------1----------------------------------11112-----------------------1--123332434224221------------2------------111111111111------1-112222------------------------------------11--1-1---1-- 1122332152214462333233343233323333332323232222332333331333233344444425444354444445555533-364355555546456662583ACGDF8953559A8QH7J5Z*F3DAE5555B5BB638863F13E8C9A855647671847787763895c76579ACDC3A95556853 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 89.8 SQ:SECSTR ######EEEcGGGGGccccTTcGGGcccHHHHHHHHHHTTcccGGGEEEcccccccHHHHTTTccHHHHHHHHHHHccTTHHHHHccccccccccTTTTHHHHHHHHHHHHHHHHHHTTcccEEEETTcccTTccTTcccTTccccHHHHHHHHHHHTTcccEEEEEccccccHHHHHHHTTcccEEEEEEEEcTTTcTcccccTTccccGGGTTcEEEEEEcTTccHHHHHHHHHHHHHHHHHHccccEEEEEcccTTcTTcTTccccccHHHHHHHHHHHHHHHTTcGHcccEEEccccccHEHHHHHHHHHHHHHHHTccccTTHHccGGGTccccHHHHHHHHHHHHccccccc################################## DISOP:02AL 1-2| PSIPRED ccccccEEEcHHHHcccccccccccHHHHHHHHHHHHHccccccccEEEcccccccHHHHHHcccHHHHHHHHHHccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccEEHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHccccEEEEEEEEcccccccccccHHHcccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccHHcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHHccccccccccccccc //