[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56753.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   142->220 3gh7A PDBj 2e-04 30.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56753.1 GT:GENE AAZ56753.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3196139..3196828) GB:FROM 3196139 GB:TO 3196828 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56753.1 GB:DB_XREF GI:71916851 LENGTH 229 SQ:AASEQ MRKFLVLLIFLLVLLAVADRGAHYAAESEIAKRISYQYEMAAKPEVTIGGFPFLTQAIGGNYQEIHVVTGAMTVEEVQVDRVDVTLTDVQAPFADLLTEPRVVAGGVEGTVLLPYSELQKRLPQGIVIETANGTPRMSGDLAYQGFSVSLSSEFRIEVNGDELTVTPDNIELGEEFVPVSTVESMLTLTMKLPRLPFDLEVTGVELLPNGIQATAVGSNVPIVGSTPQE GT:EXON 1|1-229:0| TM:NTM 1 TM:REGION 4->26| SEG 4->18|flvllifllvllava| BL:PDB:NREP 1 BL:PDB:REP 142->220|3gh7A|2e-04|30.4|79/506| OP:NHOMO 12 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------12-4----------------11---1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 34.5 SQ:SECSTR #############################################################################################################################################HHHccccEEEEcccccTTEEEEEcTTccGGGTTTcEEEEEcccEEEEEEccHHHHHHHHHHHHHHccTTTTcccccccc######### DISOP:02AL 228-229| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHcccccEEEEEEccccccccEEEEEEEEEEEEEEcHHHHHcccEEEEcccEEEEEEcccHHHHHccccccccccccEEEEEEEEEEcccEEEEEEEEEEEEcccEEEEEEccEEEccccccccHHHHHHHHHHccccccccEEEEEEEEEccEEEEEEEEccEEEEEccccc //