[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56762.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   70->210 3egdA PDBj 1e-04 13.4 %
:RPS:PFM   23->193 PF09250 * Prim-Pol 9e-11 39.9 %
:HMM:PFM   23->197 PF09250 * Prim-Pol 4.7e-18 34.2 146/162  
:HMM:PFM   2->31 PF07797 * DUF1639 0.00091 30.0 30/50  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56762.1 GT:GENE AAZ56762.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3208359..3209021) GB:FROM 3208359 GB:TO 3209021 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56762.1 GB:DB_XREF GI:71916860 LENGTH 220 SQ:AASEQ MVGVLGGRLRRRRQKRAAMVDAALEYAALGWPVCRGAQPNREGPRSCTCDRLGCPAPGVHPISAAWAMEASTDPDTIRRWWSATPEANIILPTGRVFDVLDVPTSAGVMAMAQMDRAGLTLGPVAVLDSERYLFFVATRSPIDEDEWWSCRLDCFPETVEDMPGLRWHCRDSYIPAPPSLLPSGRTVEWIRSPYGRSTPVHLPDPIAMLDILADVCGPTS GT:EXON 1|1-220:0| SEG 2->13|vgvlggrlrrrr| RP:PDB:NREP 1 RP:PDB:REP 70->210|3egdA|1e-04|13.4|127/711| RP:PFM:NREP 1 RP:PFM:REP 23->193|PF09250|9e-11|39.9|148/163|Prim-Pol| HM:PFM:NREP 2 HM:PFM:REP 23->197|PF09250|4.7e-18|34.2|146/162|Prim-Pol| HM:PFM:REP 2->31|PF07797|0.00091|30.0|30/50|DUF1639| OP:NHOMO 23 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----2-------------------------------------------------------11----14341-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5-----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 57.7 SQ:SECSTR #####################################################################HHHHHHcEEEcccEEcccHHHHTTcc######cccEEEEcTTccccccccccccccccccTTccccccTT##cEEETTTTEEEcTTTccEEEccGGGTTccTT##cccGGGcGGGccEEEEEc####cccccccEEEEEEE########## DISOP:02AL 1-2, 4-20, 219-220| PSIPRED ccccccHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEccccccEEEcccHHHHHHHHHHHHcccccccEEEccccEEEEEEcccccHHcccccccccccccccccccccccccccccEEEEcccccccccEEEEEEcccccccccccccHHHHHHHHHHHccccc //