[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56779.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   45->145 3cnuA PDBj 2e-05 12.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56779.1 GT:GENE AAZ56779.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3225798..3226307 GB:FROM 3225798 GB:TO 3226307 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56779.1 GB:DB_XREF GI:71916877 LENGTH 169 SQ:AASEQ MASLSPAARRRLAALRSALDEQLAALGEPPYAGPGHPAAALTACVQALLRAQRRGLAPHRPGVKAAVRATLAELASRYPGQAVEVRVPPYGAVQCFPGPRHTRGTPPNVVETDPLTWLALVTGDLTWADAVSSHRVSASGARADLSPALPLWSPPHEAPLHGTGTGDSR GT:EXON 1|1-169:0| SEG 2->19|aslspaarrrlaalrsal| SEG 27->40|geppyagpghpaaa| RP:PDB:NREP 1 RP:PDB:REP 45->145|3cnuA|2e-05|12.4|97/110| OP:NHOMO 69 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- ----111111111-11111-11111111111111111111111111111111111111--1-1111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 57.4 SQ:SECSTR ############################################HHHHHHHHHHHHHHc#HHHHHHHTTccEEEEEEETTEEEEEEEcTTccEE###EEEcccccccEEEEccHHHHHHHHTTcccHHHHHHHTccEEEccHHHH######################## DISOP:02AL 1-9, 161-169| PSIPRED cccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEcccccccccccccHHHccHHHHHHHHcccccHHHHHHcccEEEcccHHHHHHcccccccccccccccccccccc //