[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56802.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56802.1 GT:GENE AAZ56802.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3250002..3250349) GB:FROM 3250002 GB:TO 3250349 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56802.1 GB:DB_XREF GI:71916900 LENGTH 115 SQ:AASEQ MSMLLMLVSLLGAVLVMAVGIALVRWGAEYRGGRAFDADGIEPLPEGNGIGGYWPLVEDSTGHEPVLAPHILSRVRDLVREGREAEAVEMVREATGMDVYRAREAVALVRRNTEG GT:EXON 1|1-115:0| TM:NTM 1 TM:REGION 4->26| SEG 1->20|msmllmlvsllgavlvmavg| SEG 79->94|vregreaeavemvrea| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 113-115| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccc //