[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56807.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:303 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56807.1 GT:GENE AAZ56807.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3254628..3255539 GB:FROM 3254628 GB:TO 3255539 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56807.1 GB:DB_XREF GI:71916905 LENGTH 303 SQ:AASEQ MGKVSTSWRNGLLVLCQRSPMPREEQLSLFSPDLESPPLKPPGDQLERMRVLITVKAAPTPSKTYGETVCVAGLRLDPDCQGWVRLYPINFRALESEDQFNKYDVVSLFAKPSRLHDQRPESWRPRLDSLKIEKKLKGWKKRIPYISGFIEESMCRIYWRCKEDPQARSLAAIRPKRIYGIEVAPHPPWTPEEQRKIDKYVNQLALDSSAPRTALEAPRFAAWYRYTCWQPECRGHRQRILDWELVALQRRFRPASDQELTSIIKEKFFEEMCAPTKDTVFFVGNQAKRRHTFSVLGIYYPDR GT:EXON 1|1-303:0| SEG 131->141|kiekklkgwkk| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------1------------------ ---------------------1-------------------2------------1---------------1------------------------------------------------------------------11-1---1--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-----------------------------------------------------------------------------------------------------------1-----------------------1--------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 36-44| PSIPRED cccccccccccEEEEEEcccccHHHHHHEEcccccccccccccHHHHHEEEEEEEEcccccccccccEEEEEEEEEccccccEEEEEEcccHHccHHHHcccccEEEEEEEEccccccccHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEccEEEEEEEEEEEEcccccccEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEEEEccEEEEEEEEEEEEEEcccc //