[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56828.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->143 PF05425 * CopD 1.3e-07 33.7 92/105  
:BLT:SWISS 10->71 Y363_AQUAE 6e-05 40.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56828.1 GT:GENE AAZ56828.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3282365..3282805 GB:FROM 3282365 GB:TO 3282805 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56828.1 GB:DB_XREF GI:71916926 LENGTH 146 SQ:AASEQ MLTIWTVVRFLHVLGAALWVGGQLTVSLVVLPLARRSLDDERRATLLTAVGRRFGILTAAFFLPLQIGTGVALAWRKGVTWESLLLPGYGQILTAKLVLFALVMVAAALHGEASSRGYPVFARVMAITSVVASVGVIALAAALPAT GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 10->71|Y363_AQUAE|6e-05|40.0|60/100| TM:NTM 4 TM:REGION 8->30| TM:REGION 54->75| TM:REGION 91->112| TM:REGION 121->143| SEG 97->109|lvlfalvmvaaal| HM:PFM:NREP 1 HM:PFM:REP 49->143|PF05425|1.3e-07|33.7|92/105|CopD| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------1-------1-----------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-39,67-67| PSIPRED ccHHHHHHHHHHHHHHHHHHcccEEEEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccc //