Thermobifida fusca YX (tfus0)
Gene : AAZ56833.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56833.1 GT:GENE AAZ56833.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3288673..3289149 GB:FROM 3288673 GB:TO 3289149 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56833.1 GB:DB_XREF GI:71916931 LENGTH 158 SQ:AASEQ MIADDLLLLKTRATFPVSSSGWSVSCPPRTAHRCWGTLASAPSRKASQPSSPARPSYGVPRRRLVTVYQLIPSEELRRARAEFPHYEICVLHDDAGIPEVTAVLKPPYQGIGLAVLVCAASVSELVHTLRTAPKAKLPRRDPNRRYWPRPWELRPRPQ GT:EXON 1|1-158:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-57, 136-137, 155-158| PSIPRED cccccEEEEEEcccccccccccEEEccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHccccEEEEEEEccccccHHHHEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc //