[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56851.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  78/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.43.2d.76.1
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   130->228 3bk6B PDBj 2e-07 17.0 %
:RPS:SCOP  84->228 1winA  d.43.2.1 * 8e-12 14.0 %
:RPS:SCOP  299->348 1wh2A  d.76.1.1 * 1e-10 28.0 %
:HMM:SCOP  84->234 1winA_ d.43.2.1 * 5.3e-09 22.4 %
:HMM:PFM   38->230 PF01145 * Band_7 2.3e-19 25.2 163/179  
:HMM:PFM   300->343 PF02213 * GYF 1.7e-06 27.3 44/57  
:BLT:SWISS 3->238 YDJI_BACSU 2e-33 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56851.1 GT:GENE AAZ56851.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3310316..3311407 GB:FROM 3310316 GB:TO 3311407 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56851.1 GB:DB_XREF GI:71916949 LENGTH 363 SQ:AASEQ MIRGEFIDIIEWLDDSRDTIAWRFPRHDNEIKMGAKLIVREGQLAVFVNEGRIADVFAPGTYTLTTQNLPVLSTLQGWKYGFNSPFKAEVYFFNTRQFTDLKWGTQNPIIVRDPEFGMVRLRAFGGFALRVVDPPLLLQELVGTDPQFRTEEVAEHLRQRIVSHLAPALANSGMSVLDMAANQQALGDRLAQALSAEFASIGVAIPRFIIENISLPPEVEAALDKRAQMGIVGNLDQYTKFQAATAMERAADNPDGAMGSGMGIGMGMAMGQQMAAAFQPGAQQSAAPAGPPPLPQEQWYLAVNGQQQGPFPTAALHSHVANGTLTPDTLVWKNGMAQWTPARQVPELAPFFTPQGPPPLPPQ GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 3->238|YDJI_BACSU|2e-33|33.8|231/100| SEG 256->298|gamgsgmgigmgmamgqqmaaafqpgaqqsaapagppplpqeq| SEG 350->362|pfftpqgppplpp| RP:PDB:NREP 1 RP:PDB:REP 130->228|3bk6B|2e-07|17.0|88/142| HM:PFM:NREP 2 HM:PFM:REP 38->230|PF01145|2.3e-19|25.2|163/179|Band_7| HM:PFM:REP 300->343|PF02213|1.7e-06|27.3|44/57|GYF| RP:SCP:NREP 2 RP:SCP:REP 84->228|1winA|8e-12|14.0|136/143|d.43.2.1| RP:SCP:REP 299->348|1wh2A|1e-10|28.0|50/78|d.76.1.1| HM:SCP:REP 84->234|1winA_|5.3e-09|22.4|143/0|d.43.2.1|1/1|Band 7/SPFH domain| OP:NHOMO 95 OP:NHOMOORG 91 OP:PATTERN --1-------------1-11111----------------------1-----------111-------- -1--------------------------------------------------------------------1---------1--------------------1--12-------------------1-------------11--------------------------------1-------------------1-----------------11-1------1----------1--------------------------------------------------------------------------------1-----------1------------1-------2-1---11--11--------------11-1-----------1---------------------------------------------------1111111111--------------------------------------------------------111111---------------1---1-1--111-11111---1---1------------------1-2----1---------1-1111-1----1--1-------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111--------1------------1--------------------------- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 36.1 SQ:SECSTR #########################################################################################ccccccccEE#EEEEEE#EEEcTTc####cEEEEEEEEEEEEccHHHHHHc##cHHHHHccccHHHHHHHHHHHHHHHHHHTccccHHHHHHcHHHHHHHHHHHHHHHTGGGTEEEEEEEEEEEEccTTHHHHHHHHHH####################################################################################################################################### DISOP:02AL 244-260, 274-292, 359-363| PSIPRED cccccEEEEEccccccccEEEEEEcccccEEEcccEEEEcccEEEEEEEccEEEEEEcccEEEEEcccccHHHHHHccccccccccEEEEEEEEEEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEcHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccEEEccccHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHHHHHHHccccccccccc //