[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56868.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56868.1 GT:GENE AAZ56868.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3335427..3335738 GB:FROM 3335427 GB:TO 3335738 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56868.1 GB:DB_XREF GI:71916966 LENGTH 103 SQ:AASEQ MYQRKVGPRSSRRWSAEWWRSAEAVSRLDALWRAWEHLRLDGALGMSTWWRDHADYHMNILFPPDGPFGRSEDENKPGAPLPYTPPRRDCSLTSARGADLEAK GT:EXON 1|1-103:0| SEG 9->24|rssrrwsaewwrsaea| OP:NHOMO 10 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1---------1--113------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 5-7, 100-103| PSIPRED cccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc //