[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56886.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  103/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->113 3e11A PDBj 1e-36 64.8 %
:RPS:PDB   2->113 3e11A PDBj 1e-09 61.3 %
:RPS:SCOP  2->113 3e11A1  d.92.1.17 * 4e-38 59.8 %
:RPS:PFM   29->112 PF06262 * DUF1025 1e-17 54.8 %
:HMM:PFM   36->113 PF06262 * DUF1025 1.3e-31 52.6 78/97  
:PROS 92->101|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56886.1 GT:GENE AAZ56886.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3357988..3358332 GB:FROM 3357988 GB:TO 3358332 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56886.1 GB:DB_XREF GI:71916984 InterPro:IPR006025 LENGTH 114 SQ:AASEQ MIETSRRRFEELVADALDSIPPELTAYMDNVVITLAEDPPEPGLLGLYEGVPLTERGDSYGGVLPDQIFIYWREILAICETEEDVVEEVRITVIHEIAHHFGIDDERLHELGWT GT:EXON 1|1-114:0| PROS 92->101|PS00142|ZINC_PROTEASE|PDOC00129| BL:PDB:NREP 1 BL:PDB:REP 8->113|3e11A|1e-36|64.8|105/112| RP:PDB:NREP 1 RP:PDB:REP 2->113|3e11A|1e-09|61.3|111/112| RP:PFM:NREP 1 RP:PFM:REP 29->112|PF06262|1e-17|54.8|84/87|DUF1025| HM:PFM:NREP 1 HM:PFM:REP 36->113|PF06262|1.3e-31|52.6|78/97|DUF1025| RP:SCP:NREP 1 RP:SCP:REP 2->113|3e11A1|4e-38|59.8|112/113|d.92.1.17| OP:NHOMO 106 OP:NHOMOORG 103 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--11111111-11112111--111111111111-11--111-1111111-111-11--1-1-----------------------------------------------------11111111-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------11-----------1---------11--12-1111111---1-------1-----------------1111------------------------------1-11------------------------------------------------------------------------------------------------11112--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 98.2 SQ:SECSTR #ccccHHHHHHHHHHHHHTccGGGGTGGTTEEEEEEcccccTTccEEEEcccGGGcccTTcccccEEEEEEHHHHHHTcccHHHHHHHHHHHHHHHHHHHTTccHHHHHTTTc# DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHHHHccHHHHHHHccEEEEEEccccccccccccccEEccccccccccccccEEEEEHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHcccc //