[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56904.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:256 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   140->218 PF12483 * GIDE 1.1e-05 26.7 75/160  
:HMM:PFM   25->52 PF11177 * DUF2964 0.00056 46.2 26/62  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56904.1 GT:GENE AAZ56904.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3380932..3381702) GB:FROM 3380932 GB:TO 3381702 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56904.1 GB:DB_XREF GI:71917002 LENGTH 256 SQ:AASEQ MLVIGIALLASAAILAPMGFLAYRRWQHRHALATLCPRAFVALAGHNVTLHGRAATGPAGTVESRLAGVECVWHGHEVIRHYTTWRTVEETGERQQVLGDDRIADYSSPELFALIGPDGSPPSDQPILVDPEEADTTRVNLCLQRVVSRPQRGVPAPADDLLGRIKGRVSGIFRGETLEFEYRERAIRAGDPLIVRGRVELREGHPVLVAPEDGRLSIEHSTTAPPPVPGPPVHALLLSGSALLLGIAGLLLLVSS GT:EXON 1|1-256:0| TM:NTM 2 TM:REGION 1->23| TM:REGION 233->255| SEG 4->16|igiallasaaila| SEG 225->233|pppvpgppv| SEG 235->255|alllsgsalllgiagllllvs| HM:PFM:NREP 2 HM:PFM:REP 140->218|PF12483|1.1e-05|26.7|75/160|GIDE| HM:PFM:REP 25->52|PF11177|0.00056|46.2|26/62|DUF2964| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,53-53,143-143,146-146,151-151,157-157,160-160,179-179,185-186,188-188,193-193,221-221,249-249,255-257| PSIPRED cEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccEEEEEEccccccccHHHHHHHccEEEEEHHHHHHHHccHHHHHHHccHHHHHccccccccccccEEEEEcccccccccccEEEcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHEEEEEcccEEEEHHHHHHHccccEEEEEEEEEEEcccEEEEEccccEEEEEEccccccccccccEEEEEcccHHHHHHHHHHHHEEcc //