[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56905.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y2872_THEFY  RecName: Full=UPF0678 fatty acid-binding protein-like protein Tfu_2872;

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
b.60.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->175 3emmA PDBj 3e-16 34.2 %
:RPS:PDB   5->175 2a13A PDBj 6e-13 27.5 %
:RPS:SCOP  5->175 2a13A1  b.60.1.8 * 2e-37 31.5 %
:HMM:SCOP  3->175 2a13A1 b.60.1.8 * 2.8e-42 39.2 %
:RPS:PFM   8->175 PF08768 * DUF1794 7e-31 45.1 %
:HMM:PFM   7->175 PF08768 * DUF1794 2.6e-49 45.5 154/154  
:BLT:SWISS 1->179 Y2872_THEFY e-106 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56905.1 GT:GENE AAZ56905.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3381982..3382521 GB:FROM 3381982 GB:TO 3382521 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56905.1 GB:DB_XREF GI:71917003 LENGTH 179 SQ:AASEQ MQSEMHPELAKLSFLLGRWEGLGVAGYPDTEEFQFTQVIEFTHDGHPHLNYRSQVWRVNEDGSRGEPVTSESGYWRVRTGKAAQQEDPDQPPIHVEVLISHPEGYSEVYLGTVFAHRVELHTDVVVRTETGLPAAASHRLYGLFGDNRETLGYAWDLAANSKELQPYMSAQLQRVDRKS GT:EXON 1|1-179:0| SW:ID Y2872_THEFY SW:DE RecName: Full=UPF0678 fatty acid-binding protein-like protein Tfu_2872; SW:GN OrderedLocusNames=Tfu_2872; SW:KW Complete proteome; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|Y2872_THEFY|e-106|100.0|179/179| GO:SWS:NREP 1 GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 5->175|3emmA|3e-16|34.2|149/153| RP:PDB:NREP 1 RP:PDB:REP 5->175|2a13A|6e-13|27.5|149/151| RP:PFM:NREP 1 RP:PFM:REP 8->175|PF08768|7e-31|45.1|153/154|DUF1794| HM:PFM:NREP 1 HM:PFM:REP 7->175|PF08768|2.6e-49|45.5|154/154|DUF1794| RP:SCP:NREP 1 RP:SCP:REP 5->175|2a13A1|2e-37|31.5|149/153|b.60.1.8| HM:SCP:REP 3->175|2a13A1|2.8e-42|39.2|153/0|b.60.1.8|1/1|Lipocalins| OP:NHOMO 97 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ----111111111112222-22222222222222212122-11111-11111111111--11111112121---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----21------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1121-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 89.4 SQ:SECSTR ####ccTTTGGGGGGcEEEEEEEEEEETTEEEEEEEEEEEEEccccccEEEEEEEEcTTTccEEEEEEEEEEEEEEEcc##########cTTcEEEEEEEETTccEEEEEEEEETTTTEEEEEEEEEEcccEcEEEEEEEEEEETTEEE#EEEEEEEEEcccccEEEEEEEEEEc#### DISOP:02AL 1-2, 176-179| PSIPRED cccccHHHHHccccEEEEEEccEEccccccccEEEEEEEEEEEccccEEEEEEEEEEEccccccccccHHHccEEEEEcccccccccccccccEEEEEEEccccEEEEEEEEEcccEEEEEEEEEEEEEccccccccEEEEEEEcccccEEEEEEEEEEcccccccEEEEEEEEEcccc //