[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56913.1
DDBJ      :             regulatory protein, LuxR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  45->127 1p4wA_ a.4.6.2 * 1.5e-10 26.5 %
:HMM:PFM   71->121 PF00196 * GerE 6.8e-09 25.5 51/58  
:PROS 81->108|PS00622|HTH_LUXR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56913.1 GT:GENE AAZ56913.1 GT:PRODUCT regulatory protein, LuxR GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3393920..3394303) GB:FROM 3393920 GB:TO 3394303 GB:DIRECTION - GB:PRODUCT regulatory protein, LuxR GB:PROTEIN_ID AAZ56913.1 GB:DB_XREF GI:71917011 InterPro:IPR000792 LENGTH 127 SQ:AASEQ MCVFAVMESLFRTHRTDEEDGVEQATLVRQTTAKEELNGPVLRDCCLVPAQGRERDSNEEYARAVGLNEDELRMLAEIATGVTTDVVARRLDLSARTLRRRLRSICDRLGVNTPIEAVVWAARRHLI GT:EXON 1|1-127:0| PROS 81->108|PS00622|HTH_LUXR_1|PDOC00542| SEG 88->109|arrldlsartlrrrlrsicdrl| HM:PFM:NREP 1 HM:PFM:REP 71->121|PF00196|6.8e-09|25.5|51/58|GerE| HM:SCP:REP 45->127|1p4wA_|1.5e-10|26.5|83/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 46-66| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccc //