[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56918.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  137/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1c.5.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->91 3d1lB PDBj 1e-04 28.4 %
:BLT:PDB   73->248 2i76A PDBj 3e-08 27.2 %
:RPS:PDB   16->215 3db2C PDBj 9e-07 17.1 %
:RPS:SCOP  16->100 1e0dA1  c.5.1.1 * 2e-08 14.1 %
:RPS:SCOP  180->264 2i76A1  a.100.1.10 * 3e-19 25.9 %
:HMM:SCOP  14->176 2amfA2 c.2.1.6 * 5.3e-16 24.3 %
:RPS:PFM   16->130 PF10727 * Rossmann-like 5e-24 60.0 %
:RPS:PFM   147->266 PF10728 * DUF2520 5e-22 55.8 %
:HMM:PFM   8->130 PF10727 * Rossmann-like 9.2e-44 59.3 123/127  
:HMM:PFM   147->273 PF10728 * DUF2520 3.4e-43 48.8 127/132  
:BLT:SWISS 16->81 ILVC_THEFY 3e-05 35.9 %
:BLT:SWISS 57->249 NOTC4_MOUSE 8e-04 29.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56918.1 GT:GENE AAZ56918.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3400931..3401821) GB:FROM 3400931 GB:TO 3401821 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56918.1 GB:DB_XREF GI:71917016 LENGTH 296 SQ:AASEQ MNTAHDTRQRPARLAVGVIGPGRVGSALGAALERAGHRVVAAAAISEASRQRVAARLPHARILEPADVIAESDLVLLTVPDDALAPLTNGLAATGVTVTGKLVAHASGAHGYSVLAPLTQAGALPLALHPVMTFTGRDEDLTRLANCSFGVTTPESLRPIAEALVMEMGAEPVWIAEEYRALYHAALAHGANHLVTLVTESASLLAQAGVDHPGRMLAPLLGAALDNALRLGIDGLSGPVMRGDADTVATHLAQLREHAPESVASYLALARLTADRALAAGLLRPQDAERLLDVLT GT:EXON 1|1-296:0| BL:SWS:NREP 2 BL:SWS:REP 16->81|ILVC_THEFY|3e-05|35.9|64/331| BL:SWS:REP 57->249|NOTC4_MOUSE|8e-04|29.7|172/100| SEG 267->284|lalarltadralaagllr| BL:PDB:NREP 2 BL:PDB:REP 18->91|3d1lB|1e-04|28.4|74/252| BL:PDB:REP 73->248|2i76A|3e-08|27.2|162/244| RP:PDB:NREP 1 RP:PDB:REP 16->215|3db2C|9e-07|17.1|199/339| RP:PFM:NREP 2 RP:PFM:REP 16->130|PF10727|5e-24|60.0|115/120|Rossmann-like| RP:PFM:REP 147->266|PF10728|5e-22|55.8|120/132|DUF2520| HM:PFM:NREP 2 HM:PFM:REP 8->130|PF10727|9.2e-44|59.3|123/127|Rossmann-like| HM:PFM:REP 147->273|PF10728|3.4e-43|48.8|127/132|DUF2520| RP:SCP:NREP 2 RP:SCP:REP 16->100|1e0dA1|2e-08|14.1|85/93|c.5.1.1| RP:SCP:REP 180->264|2i76A1|3e-19|25.9|85/103|a.100.1.10| HM:SCP:REP 14->176|2amfA2|5.3e-16|24.3|152/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 138 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- 11--1------1-111111-11111111111111111111111111111111111111--111-1111111---------1--------------1--------1---1------------------------------111111----------------------------------------------1-------------------------------------------------------------1---------------------------------------------------------------------1---1----------1---1-----1----1-1111211--1111-1------1--------------------------------------------------------------------------------------------------------------------------------11111111111111-111111111------1111-------1--11-----11--------------111-----------1-1----1-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 80.1 SQ:SECSTR ###########ccEEEEEEcccHHHHHHHHHTTcTTEEEEEEEcccHHHHHHHHHHHTcEEcccHHHHTcTTccEEEcccGGGHHHHHHHHHHTTcEEEEEccccccHHHHHHHHHHHHHHccccEEEEcGGGGcHHHHHHHHHTTTTccEEEEEEEEEccHHHHccTTcGGGcTTTcTTTHHHHTHHHHHHHHHHHHccEEEEEEEEEccccccHHHHHGGGGccHHHHHHHHTHHHHHHHTcHHHH################################################ DISOP:02AL 1-8| PSIPRED cccccccccccccEEEEEEEccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccccccHHHHHHHccEEEEEccHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHcccHHHHHHHHHHcccccHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHc //