[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56922.1
DDBJ      :             possible secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->155 PF11377 * DUF3180 1e-13 42.4 %
:HMM:PFM   22->155 PF11377 * DUF3180 1.6e-40 45.5 134/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56922.1 GT:GENE AAZ56922.1 GT:PRODUCT possible secreted protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3405650..3406147) GB:FROM 3405650 GB:TO 3406147 GB:DIRECTION - GB:PRODUCT possible secreted protein GB:PROTEIN_ID AAZ56922.1 GB:DB_XREF GI:71917020 LENGTH 165 SQ:AASEQ MSSPSDNGRNGRIRPTGWRMPLAVAAVTGTIVFLVVRETYSSLVLLPWTAIPTLALLALGELITAVQVRRRIRGEPGTEPIEPLSAARLLAFAKASVLLGALACGGFTGFAVALLEWLHSPHARADALIAGGTALSGLLLVLAAVFLEYACRVPPDSNENNQVSG GT:EXON 1|1-165:0| TM:NTM 4 TM:REGION 18->40| TM:REGION 44->66| TM:REGION 91->113| TM:REGION 127->149| SEG 127->147|aliaggtalsglllvlaavfl| RP:PFM:NREP 1 RP:PFM:REP 24->155|PF11377|1e-13|42.4|132/141|DUF3180| HM:PFM:NREP 1 HM:PFM:REP 22->155|PF11377|1.6e-40|45.5|134/138|DUF3180| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1---------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 154-165| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccc //