[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56948.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->58 PF04246 * RseC_MucC 0.00047 19.6 46/135  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56948.1 GT:GENE AAZ56948.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3431286..3431528 GB:FROM 3431286 GB:TO 3431528 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56948.1 GB:DB_XREF GI:71917046 LENGTH 80 SQ:AASEQ MLTSIVRTTVPLIVGALTTFAATHLGIKLPEEVLTELVTVVVAGIYYTVARFLEERVSPAFGRILLGLGLRGTPKYEAKP GT:EXON 1|1-80:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 32->54| SEG 31->42|eevltelvtvvv| SEG 62->72|grillglglrg| HM:PFM:NREP 1 HM:PFM:REP 10->58|PF04246|0.00047|19.6|46/135|RseC_MucC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 74-80| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccc //