[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56957.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.114.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->111 2d1pB PDBj 8e-12 13.2 %
:RPS:SCOP  1->111 2d1pB1  c.114.1.1 * 5e-12 13.2 %
:HMM:SCOP  1->120 1jx7A_ c.114.1.1 * 2.7e-18 34.8 %
:HMM:PFM   10->107 PF02635 * DrsE 1.1e-10 28.3 92/119  
:BLT:SWISS 5->107 Y760_METJA 4e-08 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56957.1 GT:GENE AAZ56957.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3439568..3439930) GB:FROM 3439568 GB:TO 3439930 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56957.1 GB:DB_XREF GI:71917055 LENGTH 120 SQ:AASEQ MERVLVIKATAGEDAPERCNQAFTVAAAAVASGVRVSLWLTGEASWLAVPGRAEQFSLPHATPLNELLDVVLSSGQVTVCSQCAARRSLTEEDLIEGVRIAGAPTFVEEVMAEGAQALVY GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 5->107|Y760_METJA|4e-08|30.1|103/275| SEG 25->31|vaaaava| RP:PDB:NREP 1 RP:PDB:REP 1->111|2d1pB|8e-12|13.2|106/119| HM:PFM:NREP 1 HM:PFM:REP 10->107|PF02635|1.1e-10|28.3|92/119|DrsE| RP:SCP:NREP 1 RP:SCP:REP 1->111|2d1pB1|5e-12|13.2|106/119|c.114.1.1| HM:SCP:REP 1->120|1jx7A_|2.7e-18|34.8|115/0|c.114.1.1|1/1|DsrEFH-like| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------111----1-----------111----1111--------------------------------------------------------1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 92.5 SQ:SECSTR cccEEEEEEcccTTTcTHHHHHHHHHHHHHTTcccEEEEEcGGGGGGGcTTccTccccGGGGHHHHHTTccHHHHcEEEEHHHHHHTTccTTccccccEEEcHHHHHHHHT######### DISOP:02AL 120-121| PSIPRED cccEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccHHHccccccccHHHHHHHHHHccEEEEEHHHHHHccccHHHHHccEEEEcHHHHHHHHHccccHHccc //