[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56971.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->32 PF11194 * DUF2825 2.7e-12 48.4 31/50  
:HMM:PFM   44->93 PF11194 * DUF2825 2.1e-21 48.0 50/50  
:HMM:PFM   105->139 PF11194 * DUF2825 2.2e-13 42.9 35/50  
:REPEAT 3|3->16|64->72|125->136
:REPEAT 2|17->60|75->121

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56971.1 GT:GENE AAZ56971.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3451543..3451974 GB:FROM 3451543 GB:TO 3451974 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ56971.1 GB:DB_XREF GI:71917069 LENGTH 143 SQ:AASEQ MPGPSPRAWGSPHLRGHPMQQTRSIPTCVGLTCSSRWLDVDAAVHPHVRGAHRATALARRFDPGPSPRAWGSREHPLCVSRVTRSIPTCVGLTRPHRLAVPRMAVHPHVRGAHPGQSVAIRAGRGPSPRAWGSLRGDRGAPGR GT:EXON 1|1-143:0| NREPEAT 2 REPEAT 3|3->16|64->72|125->136| REPEAT 2|17->60|75->121| HM:PFM:NREP 3 HM:PFM:REP 2->32|PF11194|2.7e-12|48.4|31/50|DUF2825| HM:PFM:REP 44->93|PF11194|2.1e-21|48.0|50/50|DUF2825| HM:PFM:REP 105->139|PF11194|2.2e-13|42.9|35/50|DUF2825| OP:NHOMO 29 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------J------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 117-131, 134-143| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEccEEEccccccEEEEccccccccccccccccccccccc //