Thermobifida fusca YX (tfus0)
Gene : AAZ56988.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56988.1 GT:GENE AAZ56988.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3465202..3465921) GB:FROM 3465202 GB:TO 3465921 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56988.1 GB:DB_XREF GI:71917086 LENGTH 239 SQ:AASEQ MAHAPRCPEPSHAARLPGIRRVLLLSGFTFVAWVLGAAAPAFADTLDTLTGAIRHPETAVAQTTAELTELVDTALTTDRLAPLPLPQTELPVDTALAVDVDQLERTDTPLPPPVESRPAPTGTGDSPATAAGTAPEAPQPQPTAPAEASGHATAPNHVPAAADDTVEDESGPQPAEPAAPAPAAHSHAPQQGPSLTGGIVGDLTDPPAVARRDSVTALTDLSVALPPRHYVADPFFSPD GT:EXON 1|1-239:0| TM:NTM 1 TM:REGION 22->44| SEG 127->148|pataagtapeapqpqptapaea| SEG 169->193|esgpqpaepaapapaahshapqqgp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 115-194| PSIPRED cccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccEEEcccccHHHHHcccHHHHHHHHHccccHHHHcccccccc //