[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56997.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->59 PF12389 * Peptidase_M73 2.1e-06 38.8 49/199  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56997.1 GT:GENE AAZ56997.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3473823..3474449 GB:FROM 3473823 GB:TO 3474449 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56997.1 GB:DB_XREF GI:71917095 LENGTH 208 SQ:AASEQ MATRMNKRKRLVAGLGAAAVIGAAVAITGGTYAYFTDSAQTTEQAIQAGDLEVRIDQSGQGVSNKPVKIANAAPGHVYVEDLAFPHAGHRWYRMRVTNTGSIDGEINSLEIVDLTGSTPNLADRLQIRAVVKQFGFEPGSFGNPGFEPLDNGKLDNLPGIKLVPAGQSVYIYFQIEWPNGSPEEDNPYMNATTSFKFRVNLDQVNQGN GT:EXON 1|1-208:0| TM:NTM 1 TM:REGION 11->31| SEG 11->34|lvaglgaaavigaavaitggtyay| HM:PFM:NREP 1 HM:PFM:REP 8->59|PF12389|2.1e-06|38.8|49/199|Peptidase_M73| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 205-208| PSIPRED cccHHHHHHHHHccccHHHHHHHHHHHHccEEEEEEEcccccccEEEEEEEEEEEEcccccccccEEEEccccccccEEccccccccccEEEEEEEEccccEEEEEEEEEEEEEEcccccHHHHEEEEEEEcccccccccccccccccccccEEEEcccccccccccEEEEEEEEEEcccccccccHHccccEEEEEEEEEccccccc //