[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ56998.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->50 PF12389 * Peptidase_M73 1.6e-06 45.7 46/199  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ56998.1 GT:GENE AAZ56998.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3474531..3475115 GB:FROM 3474531 GB:TO 3475115 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ56998.1 GB:DB_XREF GI:71917096 LENGTH 194 SQ:AASEQ MRKKTALVLGVATACAALLLTLGGTYAYFSASAVSKPGQITAGNLSVEVDERDPSGASGFVGLRGAAPGGQWPASDSESYTLVITNTGSLSALIDSIDVVITSGRQPDLSEALEIRYSFAGGRHGPDWSQGSGWVDLVPGPILDLLPRRPAPIQPGESCALHFQLRWPNRASEYDNLFQGAETEFMFDVSLGQA GT:EXON 1|1-194:0| TM:NTM 1 TM:REGION 5->25| SEG 5->28|talvlgvatacaallltlggtyay| HM:PFM:NREP 1 HM:PFM:REP 4->50|PF12389|1.6e-06|45.7|46/199|Peptidase_M73| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 193-194| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcEEEEEEEccccccccEEEEEEEEEEEEcccccccccEEcccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEccccccccEEEEEEEEccccccccccccccEEEEcccccHHHHcccccccccccEEEEEEEEEEccccccccHHHccccEEEEEEEEEccc //