[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ57025.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->137 PF07332 * DUF1469 1e-08 37.3 %
:HMM:PFM   26->143 PF07332 * DUF1469 3e-40 49.2 118/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ57025.1 GT:GENE AAZ57025.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(3503465..3503905) GB:FROM 3503465 GB:TO 3503905 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ57025.1 GB:DB_XREF GI:71917123 LENGTH 146 SQ:AASEQ MASPQIPQQSTGSRVSAPQQRDEASLGELISEVMNDLQTLFRQELNLAKAEFREEGVKAGKAAGMLAGAGVAALLFLGFASLALVYALANVMDAGWAALIVAVLWGIAAGALAFVGRAKMRDVSPKPERTIETLKEDAQWAKHPRR GT:EXON 1|1-146:0| TM:NTM 2 TM:REGION 63->85| TM:REGION 96->117| SEG 56->84|gvkagkaagmlagagvaallflgfaslal| RP:PFM:NREP 1 RP:PFM:REP 27->137|PF07332|1e-08|37.3|110/119|DUF1469| HM:PFM:NREP 1 HM:PFM:REP 26->143|PF07332|3e-40|49.2|118/121|DUF1469| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1-----------1---------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25, 121-146| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccc //