[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ57029.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ57029.1 GT:GENE AAZ57029.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 3507054..3507566 GB:FROM 3507054 GB:TO 3507566 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ57029.1 GB:DB_XREF GI:71917127 LENGTH 170 SQ:AASEQ MRLDTSRAVDRRLDAVYRWGAVAVAVPLIITGLLGAAGHGVGFAVDHEVVPGVSAAEALGFLMVAVGSFLVGGAIVGGTVASTVNIAVGAVLVLGGLGALLVLDTPHNLLALRISDVICGFVAGMVLLTSGMYGRFSGRLPYDNPYWRSRNPRWVPEPPRRARPFFVGRG GT:EXON 1|1-170:0| TM:NTM 4 TM:REGION 18->40| TM:REGION 55->77| TM:REGION 83->105| TM:REGION 111->133| SEG 87->103|avgavlvlgglgallvl| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------------------------------------11-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 154-159| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccc //