[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35107.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:253 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->226 1vmeB PDBj 3e-07 26.1 %
:RPS:PDB   29->238 1e5dA PDBj 2e-16 18.5 %
:RPS:SCOP  25->240 1vmeA2  d.157.1.3 * 2e-35 21.5 %
:HMM:SCOP  28->244 1ycgA2 d.157.1.3 * 3.1e-37 21.1 %
:HMM:PFM   28->221 PF00753 * Lactamase_B 2.9e-22 21.6 185/194  
:BLT:SWISS 17->239 NORV_ALISL 1e-07 26.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35107.1 GT:GENE AAD35107.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 11547..12308 GB:FROM 11547 GB:TO 12308 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000657 percent identity: 70.52; identified by sequence similarity; putative GB:PROTEIN_ID AAD35107.1 GB:DB_XREF GI:4980497 LENGTH 253 SQ:AASEQ MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSL GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 17->239|NORV_ALISL|1e-07|26.5|215/499| BL:PDB:NREP 1 BL:PDB:REP 9->226|1vmeB|3e-07|26.1|199/393| RP:PDB:NREP 1 RP:PDB:REP 29->238|1e5dA|2e-16|18.5|205/401| HM:PFM:NREP 1 HM:PFM:REP 28->221|PF00753|2.9e-22|21.6|185/194|Lactamase_B| RP:SCP:NREP 1 RP:SCP:REP 25->240|1vmeA2|2e-35|21.5|209/250|d.157.1.3| HM:SCP:REP 28->244|1ycgA2|3.1e-37|21.1|213/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 100 OP:NHOMOORG 89 OP:PATTERN ------11-------11---------------------11-1----------1-1-1-11-------- -----------------------------------------------------------------------------------11211---------------------------------------------------------------------------1------------------------12--------------------------------------------------------------------------------------------------------------------------------------22-1-------1------1------1----1-------------------1-------------11------------------------------------------------------------------------3-------------------------------------------------------------------1-1--1111-1111----11----2--------------22-1-----1-----1----2---------1-----------------------1-11111----1------1-----------1----11------1--------------------------------------------------------------------------------------------1----------12-----------------111111-----11111----1------------------------------11--------------------------------1---------------------------1-1111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 96.8 SQ:SECSTR ###cEEEEccccEEEEEccTTEEEccEEEEEEEEEEcccccEEEccccGGGHHHHHHHHHTTccGGGccEEEEccccHHHHTTHHHHHHHHcccEEEEEHHHHHHHHHHHccccccEEEEcTTcEEEEEccccEEEEEEcTTcccTTcEEEEETTTTEEEEETTcTTTccccccccccGGGccHHHHHHHHHHHHHHHTGGGHHHHHHHHHHHHcEEEEcccccEEcHHHHHHHHHHHHHTTTTTccc##### PSIPRED cccccEEEEcccEEEEEEEEEcccccEEEEEEEEEEEccEEEEEEccccHHHHHHHHHHHHHccHHHccEEEEccccHHHHHHHHHHHHHccccEEEEcHHHHHHHHHccccccccEEEEcccccEEEcccccEEEEEEcccccccccEEEEEEcccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHccccEEEcccEEcc //